KEGG   Citrobacter freundii: CFNIH1_22660Help
Entry
CFNIH1_22660      CDS       T03077                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cfd  Citrobacter freundii
Pathway
cfd00020  Citrate cycle (TCA cycle)
cfd00620  Pyruvate metabolism
cfd01100  Metabolic pathways
cfd01110  Biosynthesis of secondary metabolites
cfd01120  Microbial metabolism in diverse environments
cfd01130  Biosynthesis of antibiotics
cfd01200  Carbon metabolism
Module
cfd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFNIH1_22660
   00620 Pyruvate metabolism
    CFNIH1_22660
Enzymes [BR:cfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CFNIH1_22660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHY14229
Position
complement(4632703..4634364)
Genome map
AA seq 553 aa AA seqDB search
MKKVTAMLFTMAVGLNVVSMAAKAKAAEEQETDVLLIGGGIMSATLGTYLQELEPQWSMT
MVERLDGVAQESSNGWNNAGTGHSALMELNYTPKKADGSISIEKAVEINEAFQISRQFWA
YQVNNGVMHEPRSFITTVPHMSFVWGDENVNFLRARYTALQQSTLFRGMRYSEDHAQIKE
WAPLVMEGRDPKQKVAATRTEIGTDVNYGEITRQLIASLQKKPNFALQLSTEVRGFKRNA
DNSWTVTVADLKNNEAEHDIKAKFVFIGAGGAALKLLQETDIPEAKGYAGFPVGGQFLVA
ENPDVVNRHLAKVYGQASVGAPPMSVPHIDTRILDGKRVVLFGPFATFSTKFLKNGSLWD
LLSSTTTSNFMPMVNVGLDNFDLVKYLVSQVMLNDDDRFAALQEYYPQAKKEDWRLWQAG
QRVQIIKSDAEKGGVLRLGTEVVSDKEGTIAALLGASPGASTAAPIMLHLMEKVFKDKVA
SPEWQAKLKTIIPSYGTKLNGNVEATEQELQYTSEVLGLKYDKPQVADEAPKPQLKPQAQ
PQPEQKAVADIAL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttcaccatggctgtagggctgaacgttgtctcaatg
gcagcaaaagcgaaagcggcggaagagcaggaaacggatgtactgttgattggcggcggt
atcatgagcgccacgctgggaacctatttacaagagctggagccacaatggtcaatgacc
atggtcgagcgactggatggcgtcgctcaggaaagttcgaacggctggaacaacgccgga
accggccactccgcactgatggagctgaactacacgcctaaaaaggccgacggtagcatc
agcattgaaaaggcagtcgaaatcaacgaagccttccagatttcccgtcagttttgggct
tatcaggtcaataatggcgtgatgcatgaaccacgctcatttatcactaccgtcccgcat
atgagttttgtctggggcgacgagaacgtgaatttcctgcgcgcccgttacaccgcactg
cagcagagcactttattccgtggtatgcgttattccgaagatcacgcgcagattaaagag
tgggcgccgctggttatggaaggtcgcgatccgaaacagaaagtcgcggcaacgcgcacc
gagattggtactgacgttaactatggtgaaatcacgcgccaactgattgcctcgttgcag
aagaagcccaactttgcgctgcaactgagcaccgaagtacgaggctttaagcgtaatgca
gacaatagctggaccgttacggtcgccgatctgaaaaacaacgaagcggaacatgatatc
aaggcgaagtttgtctttatcggtgccggtggcgcggcgctgaagctgttgcaggaaacc
gacattccagaagcgaaaggctatgccggattcccggttggcggccagttcctggtggca
gaaaacccggacgtagtgaatcgccacctggcgaaagtgtatggtcaggcctctgtgggc
gcgccgccgatgtcggtaccgcacatcgatacccgtatcctggatggcaagcgtgtcgtg
ctgtttgggccattcgcgacattctccaccaagttcctgaaaaacggttcattgtgggat
ctgctcagctcgaccacgacgtcgaactttatgccgatggtcaacgtaggtctggataac
ttcgatttggtgaaatatctggtaagtcaggtgatgctgaacgatgacgaccgttttgcc
gcactgcaagaatactatccgcaggcgaaaaaagaggactggcgtctatggcaggcgggt
cagcgtgtgcagatcattaaaagtgatgcagaaaagggcggcgtgctacgtctgggaact
gaagtggtcagcgataaagaaggtacgattgctgcactgctgggcgcttcgcctggtgca
tcaaccgcggcgccgatcatgctgcatctgatggaaaaagtgtttaaagataaagtcgcc
agccccgagtggcaggcgaagctgaaaacgattattccgtcttatggtactaagctgaac
ggaaacgttgaggcaactgaacaagagctgcaatacaccagcgaagttctgggtctgaaa
tacgacaagccgcaggttgccgatgaagcgccaaaaccgcagttgaaacctcaggctcaa
ccgcagcctgagcagaaagctgtggcggatatcgcgctgtaa

DBGET integrated database retrieval system