KEGG   Citrobacter freundii: CFNIH1_22745Help
Entry
CFNIH1_22745      CDS       T03077                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfd  Citrobacter freundii
Pathway
cfd00071  Fatty acid degradation
cfd00072  Synthesis and degradation of ketone bodies
cfd00280  Valine, leucine and isoleucine degradation
cfd00310  Lysine degradation
cfd00362  Benzoate degradation
cfd00380  Tryptophan metabolism
cfd00620  Pyruvate metabolism
cfd00630  Glyoxylate and dicarboxylate metabolism
cfd00640  Propanoate metabolism
cfd00650  Butanoate metabolism
cfd00900  Terpenoid backbone biosynthesis
cfd01100  Metabolic pathways
cfd01110  Biosynthesis of secondary metabolites
cfd01120  Microbial metabolism in diverse environments
cfd01130  Biosynthesis of antibiotics
cfd01200  Carbon metabolism
cfd01212  Fatty acid metabolism
cfd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFNIH1_22745
   00630 Glyoxylate and dicarboxylate metabolism
    CFNIH1_22745
   00640 Propanoate metabolism
    CFNIH1_22745
   00650 Butanoate metabolism
    CFNIH1_22745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFNIH1_22745
   00072 Synthesis and degradation of ketone bodies
    CFNIH1_22745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFNIH1_22745
   00310 Lysine degradation
    CFNIH1_22745
   00380 Tryptophan metabolism
    CFNIH1_22745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFNIH1_22745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFNIH1_22745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFNIH1_22745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfd04147]
    CFNIH1_22745
Enzymes [BR:cfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFNIH1_22745
Exosome [BR:cfd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFNIH1_22745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHY14245
UniProt: A0A023VED2
Position
4656434..4657618
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAARTAIGSFNGALATTGAVELGATVIRAALERAHLDPQRVDEVIMGNVLQSG
LGQNPARQALLKSGLSDTVCGFTVNKVCGSGLKSVALAALAIKAGQAQAIVAGGMENMSQ
APYLLDAKARWGYRLGDGQLSDVILRDGLICAEHGYHMGITAENVAKEYGISREMQDELA
LQSQRKAVAAIASGAFEAEIVPVSVSSRKKTIIFERDEFPKADSTAEGLAALRPAFDKTG
TVTAGNASGINDGAAALVVMEESAALAAGLKPLARIKAWASGGVAPAMMGMGPVPATQKA
LQLSGLRLSDIDLIEANEAFAAQFLAVGKMLGFDPQKVNVNGGAIALGHPIGASGARILV
TLLHALQARDQTLGLATLCIGGGQGIAMIVERMN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactgtgtcatcgtcagcgcggcacgtaccgcaatcggcagttttaacggcgca
ctggcaacaacgggtgccgtcgagcttggagccaccgtcattagagccgcccttgagcgt
gctcaccttgacccccaacgcgtggacgaggtgattatgggcaacgtgttgcagtcagga
ctcggacaaaatccggcgcgtcaggcattgttaaaaagcggcctgtccgacaccgtttgc
ggctttaccgtcaacaaagtgtgcggctcgggcctgaaaagcgtagcgcttgccgccctc
gcaattaaggcaggacaagctcaggcgatcgtggcgggagggatggaaaacatgagccag
gccccctacctgttagacgcaaaggcccgctggggatatcgtcttggtgatgggcaattg
tcagacgttattctgcgcgacggcctaatctgcgccgagcatgggtaccacatggggatc
accgcagaaaatgtcgccaaagagtacggcatcagccgcgaaatgcaggatgaactggca
ctgcagtcgcaacgtaaagccgtggctgccatcgcgtccggcgcattcgaggctgaaatc
gtgcccgtcagcgtgtcgtcccgtaaaaaaaccatcatctttgagcgcgacgagtttccc
aaagctgactcaacggcggaagggctcgccgccttacgcccggcctttgataaaacagga
accgtcaccgcaggcaacgcttcggggatcaacgacggtgctgcggcattagtggtaatg
gaagagtctgcggcactggcggcagggctgaaaccgctggcgcggatcaaagcctgggcc
agcggcggcgtggcaccggcgatgatggggatggggccggttccggccacgcaaaaagcg
ctacagctgagcgggttgcggctgtccgatatcgatcttatcgaagccaacgaggcattt
gccgcgcagtttcttgccgtcggcaaaatgctggggttcgatccgcaaaaggtgaacgtc
aacggcggggccattgcgctgggacatcctattggcgccagcggcgcacgaattctggtt
acgctgctgcatgcgctacaggcacgcgatcaaacgcttgggcttgccacgctgtgcatc
ggcggcggtcagggaatcgcaatgattgtggaacgcatgaattaa

DBGET integrated database retrieval system