KEGG   Chlamydia felis Fe/C-56: CF0559Help
Entry
CF0559            CDS       T00332                                 

Gene name
folD
Definition
(GenBank) bifunctional protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
cfe  Chlamydia felis Fe/C-56
Pathway
cfe00670  One carbon pool by folate
cfe01100  Metabolic pathways
cfe01120  Microbial metabolism in diverse environments
cfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CF0559 (folD)
Enzymes [BR:cfe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     CF0559 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     CF0559 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAE81331
UniProt: Q254F7
Position
656960..657823
Genome map
AA seq 287 aa AA seqDB search
MLLKGTPVAERILEKLKQKISQSPTPPGLAVVLIGNDPASEVYVGMKVKKAMNLGMVSKA
HRLPSDATLTDILKLIERLNNDPTIHGILVQIPLPKHLDSNVIIQAISPEKDVDGLHPVN
MGKLLLGQLGGFSPCTPAAVIELLNYYDIPLQGRHVAVVGRSNIVGKPLAAMLMQKHPTT
NATVTLLHSQSQNFTEILKTADIIVAAVGVPLFIQENMISPNAVIVDVGISRVATNNDKG
YMLVGDVDFNNVVTKCKAITPVPGGVGPMTVAMLMKNTWESYQKSSS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaaggcacccccgttgccgagaggattttagaaaaactcaaacaaaaaatc
tctcaaagtccaacacctccaggtctagcagtagtactcattgggaatgatcctgcatcc
gaagtttatgtcggaatgaaggtaaaaaaggctatgaatctaggaatggtgtctaaagca
catagactaccttctgatgcaacccttacagacattcttaagctcatcgaacgattaaac
aacgaccctacaattcacggtatcctagttcagatccctctgccaaagcatttagatagt
aatgtaattattcaagcaatctctccagagaaagatgtggacggtctccatcccgtaaat
atgggaaaacttttattgggacaattaggtggattttctccgtgcactccggctgcggtt
attgagctactcaactactatgatattccgcttcaaggacgtcatgttgctgttgtggga
agaagtaatattgttggcaagccattagctgcaatgttgatgcaaaaacaccccactacg
aatgcaacagtgactttgcttcatagtcaatcacaaaatttcacggaaattttaaaaaca
gctgatatcatcgtggctgccgttggggtgcccctatttattcaagagaatatgatctct
cctaatgctgtcattgttgatgtaggtatatcgcgggtcgcaacaaataatgataagggc
tacatgctagtcggagatgtagactttaataatgttgtcaccaagtgtaaagcaatcact
cctgttcccggaggtgtcggacctatgacagtggccatgctaatgaaaaatacatgggaa
agttatcaaaaatcctcctcataa

DBGET integrated database retrieval system