KEGG   Campylobacter fetus subsp. fetus 82-40: CFF8240_0640Help
Entry
CFF8240_0640      CDS       T00430                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cff  Campylobacter fetus subsp. fetus 82-40
Pathway
cff00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cff01100  Metabolic pathways
cff01110  Biosynthesis of secondary metabolites
cff01130  Biosynthesis of antibiotics
cff01230  Biosynthesis of amino acids
Module
cff_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cff00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFF8240_0640 (trpC)
Enzymes [BR:cff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CFF8240_0640 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: ABK82705
UniProt: A0RNN3
Position
652779..653555
Genome map
AA seq 258 aa AA seqDB search
MILDEIISKTKINLENIKENLPLCRLENALTNSYIPRDVKQVLKQKNSINIIAEIKKASP
SKGVIKEDFDPLKIAFEYEKAGVSAFSILTEPFYFQGSLEYIALVRRYTNTPILRKDFIV
DIYQIAEARLYGADFILLIAKALDKFYLKTLFEYAKSLNLEVLMEIHDETDLEKALFVDA
DIIGINHRNLQTFDMDMELCIKLIPLIPSGKIIVAESGLYNNSELINLKKQGADAFLIGE
HFMRQESIYNAVKDMKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgatacttgatgagataatatcaaaaacaaagataaacttagaaaacataaaagagaat
ctacccttatgcaggctagaaaatgcacttacaaactcatatataccaagagatgtaaaa
caggttttaaagcaaaaaaatagcataaatataatagctgaaataaaaaaggcaagcccg
agcaaaggcgtgataaaagaagattttgatccattaaaaatagcttttgagtatgaaaaa
gcaggtgttagcgcattttctatattgaccgagcctttttattttcaaggaagtttggag
tatatagcactagttagaagatatactaatactcctattttaagaaaagattttatagtt
gatatttatcaaatagccgaagctaggttgtatggggcggattttatacttcttatagca
aaagcgcttgataagttttacttaaaaactctttttgaatatgcaaaaagtttaaattta
gaagttttgatggaaattcacgatgagaccgatcttgaaaaagcgttatttgtagatgcc
gatataataggcattaatcacagaaatctacaaacttttgatatggatatggagctttgc
ataaagcttatacctcttatccctagtggcaaaattatagttgcggagagtggattatat
aacaattcagaactaataaatttaaaaaaacaaggtgctgatgcgtttttaataggtgaa
cattttatgcgtcaagaaagtatttataatgcggtaaaagatatgaaaggtgagtaa

DBGET integrated database retrieval system