KEGG   Caulobacter flavus: C1707_10290Help
Entry
C1707_10290       CDS       T05702                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cfh  Caulobacter flavus
Pathway
cfh00260  Glycine, serine and threonine metabolism
cfh01100  Metabolic pathways
cfh01110  Biosynthesis of secondary metabolites
cfh01120  Microbial metabolism in diverse environments
cfh01130  Biosynthesis of antibiotics
cfh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1707_10290
Enzymes [BR:cfh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C1707_10290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AYV46621
UniProt: A0A2N5CN42
Position
2222484..2223524
Genome map
AA seq 346 aa AA seqDB search
MTIARYDFASDNVAGAMPEVMEALLAANAGTASGYGSDHVSQAAGERIRAALDVDAEVKF
MPSGTAANAFALTLLASPHEAVLAHEHAHICTDETGAPGFFGQGVGLIGLPGASGKIELS
ALEEALAQPDVSYRQPAAALSLTTATEYGTVYSEAALKALVDPVKAKGYGVHLDGARLAN
AVAAGFDLKAVGRLGVDLLVMGGTKAGSTPTEAVVFLNPEHRRRLDARIKHAGQLISKGR
FLAAPWLGLLDENGGTGPWAARAAHANAMARKLADLMPYPIAHPVEANGIFVTMSDAALE
RLRGEGWFVYRFLDGSARFMCSWATTVEMVEALGAALAKIALDEPV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgcccgctacgacttcgcttccgacaacgtcgccggcgccatgcccgaggtg
atggaggcgctgctcgcggccaacgccggtacggcgtcgggctacgggagcgaccacgtc
agccaggcggcgggcgagcgcatccgcgccgcgctggacgtcgacgccgaggtgaagttc
atgccgtcgggcacggccgccaacgccttcgccctgaccctgctggcctcgccgcacgag
gcggttctggcccacgagcatgcccacatctgcaccgacgagaccggcgcgccgggcttc
ttcggccagggcgtggggctgatcggcctgccgggcgcctcgggcaagatcgagctttcg
gcgctggaggaggcgctggcccagcccgacgtctcctaccgccagccggcggcggccctg
tcactgaccacggccaccgagtacggcacggtctattcggaggcggccctcaaggcgctg
gtcgatccggtcaaggccaaaggctacggcgtgcacctggacggcgcgcggctggccaac
gccgtggcggccggcttcgacctcaaggccgtggggcggctgggcgtcgaccttctggtc
atgggcggcacgaaggccggctcgacgccgaccgaggcggtggtgttcctgaaccccgag
caccgccgccgtctcgacgcgcggatcaagcacgccggacagttgatctccaaaggccgg
ttcctggccgcgccgtggctggggctgctggacgagaacggcgggaccgggccgtgggcc
gcccgcgccgcgcacgccaacgccatggcccgcaagctggccgacctgatgccctatccg
atcgcccatccggtcgaggccaacggaatcttcgtgacgatgagcgacgcggccctcgag
cgcctgcgcggcgaggggtggttcgtctatcgcttcctggacggttcggcccgcttcatg
tgctcgtgggcgaccaccgttgagatggtggaggcgctgggtgcggctctcgctaagatt
gccctcgacgaaccggtgtag

DBGET integrated database retrieval system