KEGG   Caulobacter flavus: C1707_10340Help
Entry
C1707_10340       CDS       T05702                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cfh  Caulobacter flavus
Brite
KEGG Orthology (KO) [BR:cfh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1707_10340
Enzymes [BR:cfh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     C1707_10340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AYV46630
UniProt: A0A2N5CN47
Position
2231144..2231977
Genome map
AA seq 277 aa AA seqDB search
MSPSAPLRVGLVQTRTPATHAAALAHVAPLVREAIARGARFVLTPECTNVLQKDRDRLLP
TLTALEDDPVVNGLREIAAETGTWIDVGSALVRREDGKAANRQAVIDPTGAIVSTYDKLH
MFDVQLPTGETAKESATYTPGERAVVVDTPLAAFGLTICYDMRFPALHRALALAGAKVIT
APAAFTRPTGEAHWEVLLRARAIETGSFVIAAAQGGFHEDGRGTWGRSIAVGPWGEVIGK
LDHDEPGVLIADLDLEAADKARAAIPVLANAREFTGP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgtccgcgcccctgcgggtcggcctggtccagacccggacgcccgcgacccac
gccgcggcgctggcccacgtggcgccgctggtgcgcgaggcgatcgcgcggggcgcccgt
ttcgtgctaacgcccgagtgcaccaacgtgctgcagaaggatcgcgaccggctgctgccg
acgctgacggccctggaggacgatccggtggtgaacggcctgcgcgagatcgcggccgag
accggaacctggatcgacgtcggctcggccctggtgcggcgcgaggacggaaaagccgcc
aaccgccaggccgtcatcgatccgaccggcgcgatcgtgtccacctatgacaagctgcac
atgttcgacgtgcagctgcctaccggtgagaccgcgaaggaatcggcgacctatacgccc
ggcgaacgggcggtggtggtcgacacgccgctggcggccttcggcctgaccatctgctac
gacatgcgctttccggccctgcatcgggccctggcgctggcgggcgccaaggtgatcacc
gccccggcggccttcacccgtccgacgggcgaggcccactgggaggtgctgctgcgcgcc
cgggccatcgagaccggctcgttcgtgatcgccgccgcccagggcggcttccacgaggac
gggcgcggcacctggggtcgctcgatcgccgtcggcccgtggggcgaggtgatcggcaag
cttgaccacgacgagcccggcgtgctgatcgccgatctcgacctggaggccgccgacaag
gcccgcgcggccatcccggtcctggccaacgcccgtgaattcacgggcccctga

DBGET integrated database retrieval system