KEGG   Caulobacter flavus: C1707_13180Help
Entry
C1707_13180       CDS       T05702                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
cfh  Caulobacter flavus
Pathway
cfh00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:cfh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    C1707_13180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfh01002]
    C1707_13180
Enzymes [BR:cfh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     C1707_13180
Peptidases [BR:cfh01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   C1707_13180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3
Motif
Other DBs
NCBI-ProteinID: AYV47136
UniProt: A0A2N5D4Y7
Position
2874110..2874913
Genome map
AA seq 267 aa AA seqDB search
MTAPKTTSAFPPFTVGIVLYPGVDILDVAGPHEVFAFFNGDVIGRTIQVATVAATTDPIQ
TSGVLKVVAQYDYCAAPHIDMLFVPGSGDGLQDAIGDKALLDFLTDRAGKATYVVSVCTG
GLLLASAGLLDGYRATTHWAFVECLKLFPKVTVVNGCPRWIRDGNRITGAGISSSIDESL
FMVQTIVADMAGGPDAAAKAQLAAQQAQLSIQYNPDPPFPGGDPCSVDYDVFEPVNAGMV
EFRAAVDKAIEARLHPAASPYRATVEA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccaaagaccacgtcggcgtttccgccgttcacggtgggcatcgtgctctat
ccgggcgtcgacatcctggacgtggcgggcccgcacgaggtgttcgccttcttcaacggc
gacgtcatcggccggaccatccaggtggcgacggtggcggccaccaccgacccgatccag
acctcgggcgtgctgaaggtggtggcgcagtacgactattgcgccgccccgcacatcgac
atgctgttcgtgcccggaagcggcgacggcctgcaggacgcgatcggcgacaaggcgctg
ctcgacttcctgaccgaccgagcgggcaaggcgacctatgtggtctcggtctgcacgggc
ggcctgctgctggcctcggccggcctgctggacggctaccgcgccaccacccactgggcc
ttcgtcgagtgcctgaagctgtttcccaaggtcacagtggtcaacggctgcccgcgctgg
atcagggacggcaaccgcatcaccggggcgggcatctcgtcgtcgatcgacgagtcgctg
ttcatggttcagacgatcgtcgccgacatggccggcggccccgacgcggcggccaaggcc
caattggccgcgcagcaggcccagctgtcgatccagtacaatcccgatccgccgtttccg
ggcggcgatccgtgctcggtcgactacgacgtcttcgaaccggtcaacgccgggatggtc
gagttccgcgccgccgtcgacaaggcgatcgaggcgaggctgcacccggcggcgagcccc
tacagggcgaccgtcgaggcctga

DBGET integrated database retrieval system