KEGG   Caulobacter flavus: C1707_23500Help
Entry
C1707_23500       CDS       T05702                                 

Definition
(GenBank) kinase
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
cfh  Caulobacter flavus
Pathway
cfh00260  Glycine, serine and threonine metabolism
cfh00561  Glycerolipid metabolism
cfh00630  Glyoxylate and dicarboxylate metabolism
cfh01100  Metabolic pathways
cfh01110  Biosynthesis of secondary metabolites
cfh01130  Biosynthesis of antibiotics
cfh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C1707_23500
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    C1707_23500
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1707_23500
Enzymes [BR:cfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     C1707_23500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MeaB AAA_16 AAA_30 AAA_33 AAA_29 CbiA ABC_tran NTPase_1 NACHT SRP54 APS_kinase ATP_bind_1 PRK cobW AAA ParA IstB_IS21 DUF815 AAA_18 Zeta_toxin ArsA_ATPase TsaE AAA_23 AAA_25
Motif
Other DBs
NCBI-ProteinID: AYV48983
UniProt: A0A2N5D3F0
Position
complement(5154421..5155305)
Genome map
AA seq 294 aa AA seqDB search
MIAPDPAWLADFMRDERLDAGFAETFRVLHRPLAERLIAAARAHGRPGFVAGLSGPQGAG
KSTLVAAVARLLAEAGLKAAVLSLDDLCLTRAERRVLARDVHPLLATRGPPGTHDVALGL
SVLDGLAGQERTVLPRFDKAADDRAPRAAWPVFDGPADVVLLEGWCLGARPQGPEALASP
VNALERDEDPDGAWRGFVDAALAGPYRDLFACIDWLAVLTAPDFAAVRAWRREQEARLQA
RLAAGGASGGMDPPALERFLDHYERLTAWCAHDLPPRADVHVALDAARRPLTPS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcccgaccccgcctggcttgccgacttcatgcgcgacgagcggctcgacgcc
ggcttcgccgagaccttccgcgtcctgcatcggccgttggccgagcggctgatcgcggcg
gcccgcgcgcatggccggccggggttcgtcgccggcctgtcgggcccgcagggagcgggc
aagtcgaccctggtggcggcggtcgcccgccttctggccgaggcggggctgaaggccgcc
gtcctgtcgctggacgacctctgcctgacccgcgccgagcgccgggtcctggcgcgcgac
gtccatccgctgctggccacgcgcgggccgccgggcacgcacgacgtcgccttgggcctt
tcggtgctggatggtctggcggggcaggagagaacggtcctgccgcgcttcgacaaggcc
gccgacgatcgcgcgccgcgcgcggcctggccggtgttcgacggtccggccgacgtggtg
ctgctggagggctggtgcctgggcgcgcggcctcagggacccgaagccctggcaagcccg
gtcaacgccctggagcgcgacgaggacccggacggcgcgtggcgcggcttcgtcgacgcg
gcactggccggcccctatcgagacctcttcgcctgcatcgactggctggccgtgctgacc
gcgcccgacttcgccgccgtgcgcgcctggcgccgcgagcaggaggccaggctgcaggcc
cggctggctgccgggggcgcttcgggcggcatggatccgccggcgcttgagcgcttcctc
gaccactacgaacgcctgaccgcctggtgcgcccacgacctgccgccgcgcgccgacgtc
cacgtggcgctggacgccgcgcggcggccgcttacgccgtcctga

DBGET integrated database retrieval system