KEGG   Caulobacter flavus: C1707_23520Help
Entry
C1707_23520       CDS       T05702                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cfh  Caulobacter flavus
Brite
KEGG Orthology (KO) [BR:cfh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C1707_23520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AYV48987
UniProt: A0A2N5D3B7
Position
5158713..5159177
Genome map
AA seq 154 aa AA seqDB search
MRSTRRDSSPPLKRIRRRRGPDTGIYEARTRDIVVRVAPCYLPEESSPEQGLYLWAYTVE
IENHGVETVHLVARWWKVTDAMNRSNEVEGSGVVGEQPELRPREAFRYVSNCPLPTTSGT
MVGRYQMVTEAGEAFDAQIPEFSLHLPGAARRTN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctcgaccaggcgtgattcaagcccgcccctgaagcggatccgtcggcgccgcggc
cccgacaccggcatctacgaggcccgcacgcgcgacatcgtcgtgcgggtcgcgccctgc
tacctgcccgaggaatcctcgcccgagcagggcctctacctgtgggcctacaccgtcgag
atcgagaaccacggcgtcgagaccgtgcatctcgtcgcgcggtggtggaaggtcaccgac
gcgatgaaccgcagcaacgaggtcgagggctcgggcgtggtcggcgagcagccggaactg
cggccgcgcgaggccttccgctacgtctccaactgcccgctgccgaccacctcgggcacg
atggtcggccgctaccagatggtcaccgaggccggcgaggcgttcgacgcgcagatcccc
gagttctcgctgcacctgcccggcgcggcgcggcgtacgaactag

DBGET integrated database retrieval system