KEGG   Cellulomonas fimi: Celf_0560Help
Entry
Celf_0560         CDS       T01490                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00790  Folate biosynthesis
cfi01100  Metabolic pathways
Module
cfi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celf_0560
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Celf_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AEE44700
UniProt: F4GY32
Position
621039..621674
Genome map
AA seq 211 aa AA seqDB search
MSEAVTDGVPSRINPVTGGGRAVGEYDEQRAEAAVRELLLAVGEDPDREGLLETPARVAR
AYREIFAGLYQDPTDVLTTTFDLGHEEMVLVKDIEVYSTCEHHLVPFHGVAHVGYIPGED
GRITGLSKLARLVDVYARRPQVQERLTSQVADALVEVLQPRGVLVVVECEHLCMSMRGVR
KPGSRTVTSAVRGQMRDVATRAEAMSLVLGR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaggccgtgaccgacggcgtcccgtcgcgcatcaacccggtgacgggcggcggc
cgggccgtgggcgagtacgacgagcagcgggccgaggccgccgtccgtgagctgctgctc
gcggtcggcgaggacccggaccgtgaggggctgctggagacgccggcacgcgtcgcccgc
gcgtaccgggagatcttcgcggggctctaccaggacccgaccgacgtcctgaccaccacg
ttcgacctcggccacgaggagatggtgctggtcaaggacatcgaggtgtactcgacgtgc
gagcaccacctggtgcccttccacggcgtcgcgcacgtcggctacatccctggcgaggac
ggccgcatcacggggctcagcaagctcgcgcggctcgtcgacgtctacgcccggcgcccg
caggtgcaggagcggctgacgtcgcaggtcgcggacgcgctcgtcgaggtgctccagccg
cgcggcgtgctcgtcgtggtcgagtgcgagcacctgtgcatgtccatgcgcggggtccgc
aagcccgggtcccggaccgtcacgtccgcggtgcgcgggcagatgcgtgacgtcgcgacc
cgtgccgaggcgatgagcctggtcctcggccgctga

DBGET integrated database retrieval system