KEGG   Cellulomonas fimi: Celf_2137Help
Entry
Celf_2137         CDS       T01490                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00220  Arginine biosynthesis
cfi00330  Arginine and proline metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01130  Biosynthesis of antibiotics
cfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Celf_2137
   00330 Arginine and proline metabolism
    Celf_2137
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Celf_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SnoaL_2
Motif
Other DBs
NCBI-ProteinID: AEE46265
UniProt: F4H1G6
Position
2372126..2373022
Genome map
AA seq 298 aa AA seqDB search
MPTTAPLGLLGVPSSVAAHAPGLERGPAALRRAGLVATLRAAGRDVVDHGDTAVARWRHD
PPGRTVPHDVHRVVEVLQEARAATRAVLDAGHVPVVVGGECTVTLAVLAAAVDAGRDLGL
VYVDGGQDLHVPTGPADEPIADSTGVAHLLDLPGVHPALAGFGPRRPLLTADRLAFVGQS
DDEEDVHGLVPSLRVRADAVTADPVAAAARALAVAGRDGYLVHLDVDVLDFFALPLADVP
TYGRGLVPATLGTLLAALVRSEGFAGLVVTEANPDRDADGEHLALLVRLIADALTTGR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccaccgcacccctcggcctcctcggcgtcccgtcgagcgtcgccgcgcacgcg
cccggtctcgagcgcggccccgcggccctgcgccgtgccgggctcgtcgcgacgctgcgc
gccgcgggtcgcgacgtcgtggaccacggcgacaccgcggtcgcccgctggcggcacgac
ccgccgggacgcaccgtcccgcacgacgtgcaccgcgtcgtcgaggtgctgcaggaggcg
cgcgccgcgacgcgggcggtgctcgacgcggggcacgtgccggtcgtcgtcgggggtgag
tgcacggtcacgctggcggtgctcgcggcggccgtcgacgccgggcgggacctcgggctc
gtgtacgtggacggtggccaggacctgcacgtcccgaccggccccgcggacgagccgatc
gcggactcgacgggtgtcgcgcacctgctcgacctgcccggcgtgcaccccgcgctcgcc
gggttcggcccgcgccgcccgctgctcaccgcggaccgcctcgcgttcgtcgggcagtcc
gacgacgaggaggacgtgcacgggctcgtgccgtccctgcgcgtccgggcggacgccgtc
accgcggacccggtcgcggcggccgcccgggcgctcgccgtcgcggggcgcgacgggtac
ctcgtgcacctcgacgtcgacgtgctcgacttcttcgcgttgccgctcgccgacgtcccc
acctacggccgtggcctcgtcccggccacgctcggcaccctgctcgcggccctcgtccgc
agcgaggggttcgcggggctcgtcgtgaccgaggcgaaccccgaccgggacgccgacggc
gagcacctcgcgctgctcgtccggctgatcgccgacgccctcaccaccggccgctga

DBGET integrated database retrieval system