KEGG   Cellulomonas fimi: Celf_2244Help
Entry
Celf_2244         CDS       T01490                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00010  Glycolysis / Gluconeogenesis
cfi00520  Amino sugar and nucleotide sugar metabolism
cfi01100  Metabolic pathways
cfi01110  Biosynthesis of secondary metabolites
cfi01120  Microbial metabolism in diverse environments
cfi01130  Biosynthesis of antibiotics
cfi01200  Carbon metabolism
Module
cfi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_2244
   00520 Amino sugar and nucleotide sugar metabolism
    Celf_2244
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Celf_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEE46372
UniProt: F4H275
Position
2486753..2487523
Genome map
AA seq 256 aa AA seqDB search
MNHHHKKKHAVAFGIDIGGSGIKGAPVDLAAGEFSADRVRIPTPLPATPDAVSATVAEVV
ASFDLDTDVPIGVTFPAVILHGVAQSAANVDKSWIGTDVEAAVGAATGRRVVAVNDADAA
GYAEVRYGAAKDVDGVVLVVTLGTGIGSALVVDGRLVPNTELGHLEIDGFDAESRAADSA
RDREDLDWATWAQRLQRYFTVVENLFWPDLIVVGGGVSKHHQQFLPLLDLRTRIVPAELR
NAAGIVGAAALAARAH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaccacaagaagaagcacgcggtcgcgttcggcatcgacatcggcggcagc
ggcatcaagggcgcccccgtcgacctggccgccggggagttctccgccgaccgcgtccgc
atccccacgcccctgcccgccacgcccgacgcggtctccgcgaccgtcgccgaggtcgtc
gcgtcgttcgacctcgacacggacgtgccgatcggtgtcacgttccccgcggtgatcctg
cacggcgtcgcgcagtccgcggccaacgtcgacaagtcctggatcggcacggacgtcgag
gccgccgtcggcgccgcgaccggccgccgcgtggtcgccgtgaacgacgccgacgccgcc
ggctacgccgaggtgcggtacggcgcggccaaggacgtcgacggcgtcgtgctggtcgtg
acgctcggcaccgggatcggctccgcgctcgtcgtcgacgggcgtctcgtgccgaacacc
gagctcggccacctcgagatcgacgggttcgacgccgagtcgcgtgccgccgacagcgcc
cgcgaccgcgaggacctcgactgggcgacctgggcgcagcgcctgcagcgctacttcacc
gtggtcgagaacctgttctggcccgacctcatcgtggtcggcggcggcgtcagcaagcac
caccagcagttccttccgctgctggacctgcggacccgcatcgtcccggccgagctgcgc
aacgcggccggcatcgtcggcgcggcggcactcgccgccagggcccactga

DBGET integrated database retrieval system