KEGG   Cellulomonas fimi: Celf_3081Help
Entry
Celf_3081         CDS       T01490                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cfi  Cellulomonas fimi
Pathway
cfi00511  Other glycan degradation
cfi00520  Amino sugar and nucleotide sugar metabolism
cfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Celf_3081
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Celf_3081
Enzymes [BR:cfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Celf_3081
Chaperones and folding catalysts [BR:cfi03110]
 Intramolecular chaperones
  Others
   Celf_3081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AEE47198
UniProt: F4GZ82
Position
complement(3453602..3455092)
Genome map
AA seq 496 aa AA seqDB search
MPDVAVIPRPVLLETTDGPPFVLTAATILVVDSAPELVAVGVLAADLLGRLSGRPVEVRY
TEGGAPSVVRLRLSEDLPAGDEAYRLVVSEHRVDIDARSAAGLVRAVVTLRQTVSSLGDG
TLTVPALRVEDHPRYAWRGLSIDVARHFFTVDDLKAIIGLLAHYKLNVLHLHLTDDQGWR
VHLPSRPHLTRASAGTSVGGGPGGFYNPAQLAEIVEHAAARGIRVVPEIDVPGHVNAATH
AYGDLTPSGEPTDVYTGIEVGFSRLHDDLPATRPFLRDVFTDLAAMTPGEYVHIGGDEVL
TMDHDEYARLVGYAASVVRDAGKKVVGWQEIASTPLEPGTVVQYWDINADPAPFVAAAQA
GAHVLMSPGSRAYLDMKYDATTELGLEWAGHIELRDAYDWEPSTLIPGVPPESVIGVEAA
VWTETLTDLGELTSMLLPRLAAVAEVAWTAPQDRDWDDFAGRVAQHAPFWDRVGFRWHAS
PQVSWPGPGSAPGAAF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacgtcgccgtcatcccgcgtcctgtcctgctcgagacgaccgacggcccgccg
ttcgtcctgacggccgcgacgatcctcgtggtcgacagcgcccccgagctcgtcgctgtg
ggcgtgctcgccgccgacctgctgggccggctctcgggccggcccgtcgaggtgcggtac
accgagggcggcgcgccgagcgtcgtgcggctgcggctgagcgaggacctgcccgcgggc
gacgaggcgtaccggctcgtggtgtcggagcaccgcgtcgacatcgacgcgcgctccgcc
gcgggcctggtgcgcgcggtcgtcacgctgcgccagacggtctcgtccctcggcgacggg
accctgaccgtcccggccctgcgggtcgaggaccacccgcgctacgcgtggcgcgggctg
tcgatcgacgtcgcgcggcacttcttcacggtcgacgacctcaaggcgatcatcgggctg
ctcgcgcactacaagctcaacgtcctgcacctgcacctcacggacgaccagggctggcgc
gtccacctgccgtcccgcccgcacctgacgcgcgcgtcggcgggcacgtcggtcgggggc
gggccgggtggcttctacaaccccgcgcagctcgcggagatcgtcgagcacgcggcggcg
cgcggcatccgcgtggtgccggagatcgacgtccccgggcacgtcaacgccgcgacgcac
gcgtacggcgacctcacgccgagcggtgagccgacggacgtctacacgggcatcgaggtc
ggcttcagccgcctgcacgacgacctgcccgcgacccggccgttcctgcgggacgtcttc
acggacctcgcggcgatgacgcccggcgagtacgtgcacatcggcggcgacgaggtcctg
acgatggaccacgacgagtacgcgcggctcgtcgggtacgcggcgtcggtcgtgcgggac
gcgggcaagaaggtcgtcgggtggcaggagatcgcgtcgacgccgctcgagcccggcacg
gtcgtgcagtactgggacatcaacgccgacccggcgccgttcgtcgccgcggcgcaggcg
ggcgcgcacgtgctcatgtccccggggtcgcgcgcgtacctcgacatgaagtacgacgcg
acgaccgagctcggcctggagtgggccgggcacatcgagctgcgcgacgcctacgactgg
gagccgtcgaccctgatcccgggcgtgccgccggagtcggtgatcggcgtcgaggcggcc
gtgtggacggagacgctgacggacctcggcgagctcacgtcgatgctgctgccgcggctc
gcagccgtcgcggaggtcgcgtggacggctccgcaggaccgggactgggacgacttcgcg
ggccgcgtcgcgcagcacgcgccgttctgggaccgcgtcggcttccgctggcacgcgagc
ccgcaggtgtcgtggccggggccgggttccgcgccgggcgcggcgttctga

DBGET integrated database retrieval system