KEGG   Colletotrichum fioriniae: CFIO01_00531Help
Entry
CFIO01_00531      CDS       T04796                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00190  Oxidative phosphorylation
cfj01100  Metabolic pathways
Module
cfj_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFIO01_00531
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     CFIO01_00531
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     CFIO01_00531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa DUF2087
Motif
Other DBs
NCBI-ProteinID: EXF82017
UniProt: A0A010QPH7
AA seq 286 aa AA seqDB search
MATKLYRSRALAGLRNCRPSEIRSFSTSIPQLAGFPTGFPKDAENMRKSPREHIGTLKAP
LINPADKYGSKADNLHKYGSWIMGCLPKYVQQISVWKDELTIYVSPSGIIPVFSFLKYNT
SAEYTQISDITAVDYPTRDQRFEVIYNLLSVRHNSRIRVKTYADEASPVPSVTSLFDGAN
WYEREVYDLFGVFFADHPDLRRIMTDYGFEGHPLRKDFPLTGYTEVRYDEEKKRIVTEPL
ELTQAFRNFEGGSSAWEGVGPGTDRRPDTFKLPTPKPEEKKEEPKK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaagctctatcgtagcagagctctggcgggcttgcgcaactgccgccccagc
gagattcgatccttctcaacctcaatccctcaattggctggcttcccgaccggctttccc
aaggatgccgaaaacatgaggaagtctcctcgcgagcacatcggcaccctcaaggctcct
ctcatcaaccctgccgacaagtacggctccaaggccgataacctccacaaatacggctct
tggatcatgggctgcttgcccaagtacgtccagcagatctctgtctggaaggacgagctc
accatctacgtctctccctcgggtatcattcccgtcttctccttcctcaagtacaacact
tcggccgagtacacccagattagcgacatcactgccgtcgactacccgaccagagaccag
cgattcgaggtcatctacaaccttctcagtgtccgccacaactcgcgcatccgcgtcaag
acctacgccgacgaggcgtcccccgtccccagtgtcacctccctcttcgatggagccaac
tggtacgagcgtgaggtctacgaccttttcggcgtcttcttcgccgaccaccccgatctg
cgcagaatcatgaccgactacggttttgagggccatcccctgcgaaaggacttccccctt
actggctacaccgaggtcagatacgacgaggagaagaagcgcatcgttaccgagccactt
gagcttacccaggctttccgcaacttcgagggtggctcaagtgcttgggagggagttgga
cctggcacggacagacgccccgacaccttcaagctgcctacgccgaagccagaggagaag
aaggaggagccgaagaaatag

DBGET integrated database retrieval system