KEGG   Colletotrichum fioriniae: CFIO01_01112
Entry
CFIO01_01112      CDS       T04796                                 

Definition
(GenBank) ergosterol biosynthesis ERG4/ERG24 family protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00100  Steroid biosynthesis
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CFIO01_01112
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CFIO01_01112
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: EXF80741
UniProt: A0A010RJY9
AA seq 490 aa
MASKSEKDAVQKPHGYEFGGPIGAFGISFGLPILVYLFTFSCNDVSGCPAPSLLSPSTLK
LDQLKREVGWPEEGIWGLADNKVTAAVLGYYLFNALLYRILPATEVDGVELASGGRLKYR
CNSFASSMFILTVCLAGTIAQGAEFPLWTFITDNYIQVVTANMLIAYGIATFVYVRSFSV
KQGNKELRELAAGGHSGNLIYDWYIGRELNPRVTIPLLGEIDIKEWLEIRPGLLGWSLMN
FAWMARQYRTYGFVTNSSVFVSAVQLAYVIDCWWNEPAILTTIDITTDGFGFMLSFGDLV
WVPFVYSLQTRYLAVYPVSMSPLGMAGIVGLIGVAFSIFRLSNSQKNAFRSNPDDPSVAH
LKYIETKTGSRLLVSGWWGVARHINYLGDWLQAWPYCLPTGMAGYTIVSAGTGYAQAGLE
GAFKMADGREVIQGAARGMATPITYFYIVYFAVLLIHRDRRDDEKCSRKYGEDWEKYKKI
VRWRILPGVY
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggcgtccaaatcagagaaggacgcggtccaaaagccgcatggctatgagttcggagga
cccatcggcgccttcggcatctctttcggtctcccgatcctcgtctacctcttcactttc
agctgcaacgatgtatccggctgccctgctccttcccttctgagcccctcgaccctgaag
ctcgaccagctcaagcgcgaagtcggatggcccgaggagggcatctggggtctcgcagac
aacaaggttactgctgccgtcttgggatactacctcttcaacgcgctcctctatcgtatc
cttcccgcgaccgaggtcgatggcgttgagctcgcctctggtggccgtctgaagtacaga
tgcaactcctttgcttccagcatgttcatcctgaccgtctgcctcgccggcaccatcgcc
cagggcgccgagtttcccctctggaccttcattaccgacaactatatccaagtcgtcacc
gccaacatgctcattgcctatggtattgcgacgttcgtatacgtgcgaagctttagcgtc
aagcagggcaacaaggagctccgcgaattggctgcgggtggacactctggcaacctcatc
tacgactggtacattgggcgtgagctcaaccctcgcgtgaccattcctctcctgggcgaa
atcgacatcaaagagtggctggagatccgacctggtctgttgggctggtctctgatgaac
tttgcatggatggctagacagtaccgcacctacggcttcgtcacgaacagcagtgtcttc
gtctccgccgttcagcttgcgtacgtgatcgactgctggtggaacgagcccgcgatcctg
acgaccattgacatcaccacggacggctttggcttcatgctgtcctttggcgacctcgtc
tgggtacctttcgtctactccctgcagactcgttacttggctgtgtaccccgtctcgatg
agccccttgggcatggctggtatcgtcggactcatcggtgttgccttctccatcttccgc
ctgtccaacagccagaagaatgcgttccgcagcaacccggatgaccccagcgtcgctcac
ctcaagtacatcgagaccaagaccggaagccgcctccttgtatcgggctggtggggagtc
gctcgtcacatcaactaccttggcgactggctccaggcctggccatattgcttgcccaca
ggcatggctggatacacaatcgtctcggcgggcactggatacgcccaagccggactcgag
ggagctttcaagatggctgatggtcgtgaggttatccagggcgcggctcgtggcatggcg
actcccatcacgtacttttacattgtgtactttgccgtcttgttgatccaccgcgaccgc
cgtgatgacgagaagtgctctcgcaagtacggcgaggactgggagaagtacaagaagatt
gtccggtggagaattcttcctggcgtctactga

DBGET integrated database retrieval system