KEGG   Colletotrichum fioriniae: CFIO01_01932Help
Entry
CFIO01_01932      CDS       T04796                                 

Definition
(GenBank) succinate-CoA ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00020  Citrate cycle (TCA cycle)
cfj00640  Propanoate metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
cfj01200  Carbon metabolism
Module
cfj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFIO01_01932
   00640 Propanoate metabolism
    CFIO01_01932
Enzymes [BR:cfj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CFIO01_01932
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CFIO01_01932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: EXF74454
UniProt: A0A010R9Q5
AA seq 357 aa AA seqDB search
MATKLSPQLKCLSRRLRAPKLARGFSFTAENRGTYESTIANLNIDQNTRVIYQGFTGKAA
TKNARDTMEYGTQIVGGVSPGKGGQDHLGLPVFDTVQEVRNPQYPPSHVLQLTRYCPQAV
KNVKPHASAVFVPAQFAAGAIIEAIEAEIPLVVSVAEHVPLHDMARVQEILRTQSRTRLV
GPNCPGIIAPDQCRIGIMPYKQYTKGVVGIVSKSGTLSYEAVGATTKAGLGQSIVVGMGG
DMMPGTTLLDGLKLFFAHEETKGIIVIGEIGGEAELKAAEAIRDYRKLTPNPKPIIAMVA
GRTAPQGKTMGHAGAILSPRDVPADIKAKALEEAGAIVVPHPGVMGNEMRRLINLQV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaaattgtctccccaactcaagtgcttgtctcggagacttcgagctcccaaa
cttgccaggggattctcgttcacagccgagaatcggggtacatacgaaagtacaattgcc
aatctaaacattgaccagaacaccagagtgatatatcaaggatttactggtaaagcagcc
accaaaaatgcaagagacacgatggaatatggcacgcagattgttggaggcgtctccccc
gggaagggcggtcaggatcacctcggactacccgtgtttgacacagtacaagaagtacga
aatcctcaatatcctcccagccatgtgcttcagctgacgaggtactgtccacaggccgta
aagaatgtgaagccacacgcaagcgcagtctttgttcctgcccaatttgcagcaggggct
atcattgaagcaatcgaggctgagattccgctcgtcgtttcagtcgctgaacatgtgccc
cttcacgatatggctagggttcaagagattctccgaacgcaaagtagaactcggcttgtg
ggacccaattgccccggaatcatcgcacccgaccaatgccgcattggcatcatgccgtac
aagcagtacacaaaaggtgttgttgggattgtttccaaaagcggaacactcagttacgaa
gctgtaggggccacaaccaaagctggacttggacagagtatcgttgttgggatgggagga
gacatgatgccagggactacacttttggacgggctcaagttattctttgcacatgaagag
accaagggaatcatcgtcattggcgagattggcggcgaagctgagctaaaagcagcggag
gccataagagattacagaaagttgacgcctaacccaaagccaatcattgcaatggtcgct
gggagaacggcgccgcaaggaaaaacgatgggtcatgctggtgctatcctttcaccgaga
gatgtgcctgccgatattaaagcaaaggcactcgaggaggcgggtgcaatcgttgtgccg
cacccgggagtcatgggcaatgagatgagaaggcttattaatttgcaggtatag

DBGET integrated database retrieval system