KEGG   Colletotrichum fioriniae: CFIO01_03816Help
Entry
CFIO01_03816      CDS       T04796                                 

Definition
(GenBank) mannitol dehydrogenase domain-containing protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00051  Fructose and mannose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CFIO01_03816
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CFIO01_03816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: EXF81612
UniProt: A0A010QNE0
AA seq 395 aa AA seqDB search
MSTQQFTKKAVHFGAGNIGRGFVACFLHNSGYEVVFADVADALIDKLNETPSYRVIEVGA
EGTNENTITNYRAINSRTHEAELVEEIATADVVTCSVGPNILKFIAPVIAKGIDKRPSDL
APISVIACENAIGATDTLAEHIKDPRNTAAHRLEDHHERARYANSAIDRIVPAQDPNAGL
DVTLEKFYEWVVERTPFEEIPSIEGINWVDELAPFIERKLYTVNTGHATAAYHGYNRGKR
TVYDALQDKAIMAEVRKALEETSNLIISKHGIDEKAQREYAAKIIRRIGNPHLEDAVERV
GRAPLRKLSRKERFVGPAAELAEKGEDCTALLRAAEMAFRFQDVEGDDESKELSKLMSEN
SPEEAVTKICGIQSSEKIHPMLAAVVRKVQADSEE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaacaatttactaagaaggccgtccacttcggcgccggcaacatcggccgt
ggcttcgttgcctgctttctccacaactccggctacgaggtcgttttcgccgacgtcgcc
gatgctctcatcgacaagctgaacgagaccccttcataccgggttatcgaggtcggcgct
gagggcaccaacgagaacactatcacaaactaccgcgccatcaactcaagaacacacgag
gcagagttggtcgaggagattgccacagctgatgttgtcacgtgttccgtcggcccgaac
atcctcaagttcatcgcccctgtcatcgccaagggtatcgacaaacgtcccagcgacctg
gcacccatctctgtcattgcctgcgagaacgccattggcgccaccgacacccttgctgag
cacatcaaggaccctcgcaacactgccgcccaccgcttggaggatcaccacgagcgtgct
cgctatgccaactccgctattgaccgcattgtccctgctcaggaccccaacgctggtctc
gacgtcactctcgagaagttctacgagtgggttgtcgagcgtacacccttcgaggagatc
cccagcattgagggcattaactgggtcgatgagctcgctcctttcattgagcgcaagctg
tacacagtcaacactggacacgctactgctgcctaccacggttacaaccgcggtaagcgc
accgtctacgatgcgctccaggataaggctatcatggccgaggttcgcaaagctcttgag
gagacgagcaacctgatcattagcaagcacggtattgacgagaaggctcagcgtgaatac
gctgccaagatcattcgccgcatcggcaacccccacttggaggacgctgttgagcgtgtt
ggtcgcgcacctctccgcaagctgagccgcaaggagcgcttcgttggtcccgcagctgaa
ctcgccgagaagggtgaggactgcactgctctgctccgcgcagctgagatggccttccgc
ttccaggatgttgagggcgatgatgagagtaaagagctctccaagctcatgtctgagaat
tctcccgaggaggctgtcaccaagatttgcggcatccagtcttctgagaagattcacccc
atgctggctgccgtcgtccgcaaggtccaggccgacagtgaggaatga

DBGET integrated database retrieval system