KEGG   Colletotrichum fioriniae: CFIO01_04677Help
Entry
CFIO01_04677      CDS       T04796                                 

Definition
(GenBank) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00010  Glycolysis / Gluconeogenesis
cfj00071  Fatty acid degradation
cfj00350  Tyrosine metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFIO01_04677
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFIO01_04677
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CFIO01_04677
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CFIO01_04677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N AlaDh_PNT_C NAD_binding_2 Methyltransf_11 3HCDH_N 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: EXF72971
UniProt: A0A010QYB0
AA seq 321 aa AA seqDB search
MKAFRFLGPDKGLVLQDVPIPSPSPEQALIRVKAAGLCHSDTHVLHGGGAAWMCALPVTL
GHEVSGIITELGDSSNTSFKVGDRVAVACVGHPIQERNFQEALGVGCDGGYAEYALAPVK
NLVKIPDQVGFAEAAVATDSVATAYHAVVTEGRVSKSHTVAVIGLGGLGLNGLAIAAHRG
ARVFGVDINTDKFEQANEFGAVNCATDLRTFSDETFDVILDFAGAQKTVEAAISSVRPGG
CVVLVGLAAQSVQITTTAIVTQNVSLKGSTSASIQEFREVLDLIASGSIKPSTKEIPFED
IEKGLELLGNGNVNGRLYTVP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctttcgtttcctcggccccgacaaaggccttgtcctccaggacgttcccatt
ccgtccccgagccccgaacaggccctcatccgcgtcaaagccgccgggttgtgccactcc
gacacccacgtcctccacggcggcggcgcagcgtggatgtgcgcgctgcccgtaacgtta
ggccacgaggtctctggcatcattacggagctaggcgactcttcaaacacatcattcaaa
gtcggtgatcgggtagctgtcgcctgtgtgggtcacccgatccaagagagaaacttccag
gaagccctgggcgtaggctgcgacggcggatatgctgaatatgctctcgctcccgtcaaa
aatctcgtcaagattccagatcaggttggatttgccgaggctgctgtggctaccgattcc
gttgccactgcctaccacgccgtcgtcaccgagggccgggtgtccaagtcgcacacggtt
gctgtcattggtctaggcgggttggggctgaacggactggcgattgccgcacaccgcggt
gctagagtgtttggcgtcgatatcaacacggacaagtttgaacaggccaatgaattcggc
gccgtcaactgtgccacagatttgagaacattctcagacgaaacgttcgatgttatcttg
gactttgcaggagctcagaagacggttgaggctgcgatatcctcggtgagacctggcgga
tgcgtggtgctagtggggcttgcggcccagagcgtgcaaatcacgaccacagcgattgtc
acgcagaatgtctcgctcaaaggctcgacgagcgctagcattcaggagtttagagaagtg
ttggacttgatcgcatcagggtccataaaaccatccacgaaggagattccattcgaggat
atcgagaagggacttgagttattgggtaatggaaatgtcaacggacgtctgtacactgtt
ccttga

DBGET integrated database retrieval system