KEGG   Colletotrichum fioriniae: CFIO01_06523Help
Entry
CFIO01_06523      CDS       T04796                                 

Definition
(GenBank) hypothetical protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CFIO01_06523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cfj03032]
    CFIO01_06523
   03036 Chromosome and associated proteins [BR:cfj03036]
    CFIO01_06523
   03400 DNA repair and recombination proteins [BR:cfj03400]
    CFIO01_06523
Enzymes [BR:cfj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     CFIO01_06523
DNA replication proteins [BR:cfj03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     CFIO01_06523
Chromosome and associated proteins [BR:cfj03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    CFIO01_06523
DNA repair and recombination proteins [BR:cfj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     CFIO01_06523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR BRCT PTCB-BRCT BRCT_2
Motif
Other DBs
NCBI-ProteinID: EXF74846
UniProt: A0A010R3N3
AA seq 751 aa AA seqDB search
MSAPRRSGRTAAAATSAAPTTPAAQPLAGTVIAISGTFDKKRTDLESWLSSLGAGIAKSI
TKKTTHLITTLEEFKAVTTKVASAQKNGIFIVTLDWAEKCESQGSKVAESDFEPGKTATT
KAKAPPAAATNGSTKKNGASAQSNSSQQNGSQSQSQTSTASKASAASKKRVKADAQSDND
SDADVKPDVKKQKAAAGAKGKKKAAGSAAAVNDADDKTDVKKKAASGDAQTVSKGIVVPL
DEGCKVQGTVYIAPDGVIYDASLNQTNASNNNNKFYRIQLVQDGKTFKTWTRWGRVGEFG
QSAVLGNGSLDDALKNYDKKFRDKSGIAWAKRADPPKPGKYAFVERSYEPDSDDDEDDNK
AGEAGDVKKEEDDNDDDMADPVKSSLPQPVQDLMGLIFNQQYFREAMTSMNYDANKLPLG
KLSKNTILRGFQVLKDLAALFNDSTLADSEYHMSVPAATEHLSNSYYSLIPHAFGRNRPP
IIGSGAMLKKEVDLLDSLSDMKVAADLMKVDRKNTDVHQADRQYQGLGMEEMTPLDRKST
EFTLLAEYLNGSKGSTHGHTYKIEDIFRIERQGELERFEKSEFSSIKSDRRLLWHGSRVT
NYGGILSQGLRIAPPEAPVSGYMFGKGIYLADMSSKSANYCASYNSGGQALLLLCEAELG
DPMQKLTNASYNAGDDAKAGGMWSTWGQGNTGPSKWKDASCVNPDLKGIQMPDVSVTPGP
TNVPGAYLMYNEYIAYDLAQVRLRYLFRVKM
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccaaggcgatcagggagaacagctgcagcagctacaagcgctgctcccacg
acccctgcggcccagccattggctggcactgtcatcgccatcagtggcacctttgataag
aagcggacggatctcgagtcgtggctctcctcactcggtgccggcattgccaagtcaatt
accaagaagaccactcatcttattacgacacttgaggaattcaaagctgtcaccaccaaa
gttgcttccgcccagaagaacggcatcttcatcgtcaccctcgattgggccgagaagtgt
gagtctcaggggtccaaggtcgccgaaagcgattttgagcccggcaaaaccgcaacgacc
aaagcaaaggctcccccggctgcagccacaaacggttccacaaagaagaatggagcttca
gcgcagtccaacagctctcagcagaacggctcgcagtcgcagtctcaaaccagcactgca
tccaaggccagtgccgcaagcaagaaacgcgtcaaggcagatgctcagtccgacaatgac
agtgatgctgatgtcaaacccgacgtgaagaagcaaaaagctgccgccggtgccaagggc
aagaagaaggctgctggttctgcggccgcggttaatgatgctgacgacaagactgacgtg
aaaaagaaggctgcaagcggtgacgcccagactgtctccaaaggaatcgtggttcctctt
gacgagggctgcaaggtgcagggaaccgtctacattgcacctgacggtgtcatctacgac
gcatctctgaaccaaacaaacgcctcgaacaataacaacaagttctatcgtatccagctt
gtccaagatggcaaaacgttcaaaacatggacccgctggggccgagtcggagaattcggc
cagtctgctgttctcggcaatggcagcctcgacgatgcgttgaagaactatgacaagaag
ttcagagacaagagcggtatcgcctgggccaagcgcgcagaccctcccaaacccggcaag
tatgcctttgttgagcgcagctacgagccagactcggacgacgatgaagatgacaacaag
gcgggggaggccggcgacgtcaaaaaggaagaagatgacaatgacgacgacatggcagac
ccagtcaaatcatcccttcctcaaccggtgcaggacctgatgggcctcatcttcaaccag
cagtacttccgtgaggccatgacctccatgaactacgatgccaacaagctgcccctcgga
aagctcagcaaaaataccatcctcagaggttttcaggtgctcaaagacttggccgctctt
ttcaacgacagcacgcttgctgactctgagtaccacatgtctgtcccggccgcgactgag
cacttgtccaactcgtactactcgctgattccccacgcctttggtcgcaaccgtccgccc
atcattggctctggtgctatgctgaagaaggaagtcgacttgctcgacagtttgtccgac
atgaaggtcgcagcggaccttatgaaggttgatcgcaagaacacggacgttcaccaagcc
gacaggcagtaccagggtcttggaatggaggagatgactccccttgaccgcaagagcaca
gagttcacccttcttgccgagtacctgaatggatccaagggctctacccacggccacacc
tacaagattgaggacatcttccggattgaacgacagggcgagctggagcgcttcgagaag
agcgagttctcatccatcaagtcggaccgcagattgctgtggcatggctcccgagtcacc
aactatggtggtattctcagccagggtctccgaatcgcccctcctgaggctcccgtgtcg
ggctacatgtttggcaagggaatttaccttgccgacatgtcgagcaagtcagcaaactac
tgcgcctcttataactcagggggtcaagcgttgctgctgctttgtgaggccgaacttgga
gacccgatgcagaagctcacgaacgcgagctacaacgcgggtgatgatgcaaaggcgggc
ggcatgtggtccacttggggtcagggtaacaccgggccgagcaagtggaaggatgccagc
tgtgtcaacccggaccttaagggtatccaaatgcccgacgtgagcgtcacgccaggcccc
accaatgttccaggcgcatacctcatgtacaacgagtacattgcttacgaccttgcccaa
gtccgcctccgctacttgttccgagtcaagatgtga

DBGET integrated database retrieval system