KEGG   Colletotrichum fioriniae: CFIO01_07076Help
Entry
CFIO01_07076      CDS       T04796                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00052  Galactose metabolism
cfj00500  Starch and sucrose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CFIO01_07076
   00500 Starch and sucrose metabolism
    CFIO01_07076
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CFIO01_07076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: EXF75440
UniProt: A0A010QFC1
AA seq 614 aa AA seqDB search
MRQHLFYTSLLSALLAAPSYALPGFFSDAERAHFSSDLKRSIDDESPAAIMARQAADRSG
RWRPQIHFSPPAEWLNDPNGLFVDSDGVWHMYYQYADNVAGDGVKNWGHTTATEFYNWVD
HPVAIPATARDGSIWSGSVVVDRNNTSGFFPSDKTSGKDNIIAYYTSWEPDQESQHLAWS
YDGGETFNQYENNPIISLNRHGFRDPKPSFHHETNTWVMVLSLESEVAFYTSTNLVNWTQ
SSIWNPQRNIGLIECPQFLQIPRKDKSGSIVGAKWVLTLSLGGGGPTGGAAVKYITGEWD
GTTFTPDVPASLGSRRGIFSRQDTFSIYDFDFGPDKYATAFFHFQNLNDANQDAYSVSWA
VDATLYGCCTPTDQEGWRHCMGGVRRHWLDSNTNRLMSAPAGDLSKLVSTTSGWNPILDE
KDVSGIQGSSAVIRDYNPAVEWTLTVKMAKSLLQEGSTASAQLAFQGSQSNGTEQVSLGF
DFTGTSNSGAPTANLNIGRASAVWDRSGTFGVSNVQALEAASSEGSSGNVEFQLHGILDR
SVLEVYVNGGVEAGTMLYFTDKPLDSIVLSRGTGTNDQGITFDFKAVALKSSWGSYEEKA
VLQSTQDKWRTEEL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcatcttttctacacatcgcttctgtcggcattgctcgcagcaccgtcgtac
gctctgcccggcttcttctccgatgcagaacgcgcccatttttcatcagacctcaaacgc
tcaatagacgacgaatctccagcagcaatcatggcgagacaagcagccgatagatccggc
cgctggcggccccaaatccacttctcaccacccgccgaatggcttaatgatccaaacggc
ctctttgtcgactcggacggtgtctggcacatgtactaccaatatgccgacaacgtcgcg
ggcgatggcgtgaagaactggggccacacgacggctacagaattctacaattgggttgac
caccctgttgccattcccgccactgcacgcgatggctccatctggtcaggaagtgtcgtc
gtcgacaggaacaatacgtctggcttcttcccgtctgacaagacaagcggaaaggacaac
atcattgcctactatacctcatgggagcctgaccaggaatcccagcatcttgcatggtca
tacgatggcggcgagaccttcaaccagtacgagaacaacccaattatttcgctcaacaga
cacggattccgcgaccccaagccctcgttccaccatgagaccaacacctgggtcatggtc
ctttccctcgagagtgaagtcgccttctacacctccaccaacttggtcaactggacgcag
tcatccatctggaatcctcagcgcaacattggcctgattgagtgccctcaattcctccag
attccccgaaaggacaagtctggaagcatcgtgggcgccaaatgggttctgactctcagt
ctgggaggcggcggcccgacgggcggtgctgcagtcaagtacatcaccggcgagtgggac
ggcaccaccttcaccccggatgtgccggccagcctcggctcgcggagaggaatcttctcg
cgccaggacaccttctccatctacgactttgactttggccctgataagtacgccaccgcc
ttcttccatttccagaacctcaacgacgccaaccaagatgcatactccgtctcatgggca
gtcgacgctacgctctatgggtgctgcacgccgaccgaccaagagggatggcgtcactgt
atgggtggtgtgcgccgccactggctggactccaacaccaaccgactcatgtcagcacca
gccggcgacctatccaagctcgtgagcacgacgtccggctggaaccccattcttgacgag
aaggacgtgtcgggcattcagggcagcagcgccgtcatccgcgactacaacccggctgta
gagtggaccttgaccgtcaagatggccaaatctctcctccaggaaggctcgacggcctca
gcccagctggccttccagggctctcagtccaacggcacggagcaagtctccctcggtttc
gacttcactggcacctccaacagcggggcacccacagccaacctcaacattggccgcgcc
agcgcggtgtgggataggtccggcacgtttggcgtctccaacgtccaggctcttgaggcc
gcctcgagcgagggctccagcggcaacgtcgagttccagctgcacggcattctcgaccgc
tccgtccttgaggtctacgtcaatggcggcgtcgaggccggcaccatgctctacttcacg
gacaagcccctcgacagcatcgtcctctcccgcggcacgggaaccaacgaccagggcatc
acctttgacttcaaggccgtagcactcaagagctcctggggttcgtacgaggagaaggcc
gtcttgcagagcacgcaggacaagtggaggacggaggagctgtga

DBGET integrated database retrieval system