KEGG   Colletotrichum fioriniae: CFIO01_10137Help
Entry
CFIO01_10137      CDS       T04796                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00072  Synthesis and degradation of ketone bodies
cfj00280  Valine, leucine and isoleucine degradation
cfj00650  Butanoate metabolism
cfj00900  Terpenoid backbone biosynthesis
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
Module
cfj_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CFIO01_10137
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CFIO01_10137
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFIO01_10137
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFIO01_10137
Enzymes [BR:cfj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     CFIO01_10137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N
Motif
Other DBs
NCBI-ProteinID: EXF77364
UniProt: A0A010RHQ7
AA seq 463 aa AA seqDB search
MASRPENIGIKAIEIYFPNQYVEQTELETFDGVSAGKYTIGLGQTKMAFCDDREDIYSFA
LTVTSNLIKKYNIDTNSIGRLEVGTETLLDKSKSVKTVLMQLFGENTNIEGVDTVNACYG
GTNAFLNSVNWIESSAWDGRDAIVVAGDIALYAKGNARPTGGAGAVAMLVGPNAPVVLEP
GLRGTYMSHVYDFYKPDLTSEYPYVDGHYSLTCYTKALDAAYREYNKREAKLAKAANGHA
NGNGATNGESKIPKTSLDRFDYFSFHAPNCKLVAKSYARLLYHDYLADADSPVFAEVAPE
LRDMDYEKSLTDKVVEKTFMGLTKKKYQERVAPGAQVATLLGNMYCGSVWGGIASLLSYV
DAATLKDKRVGVFSYGSGLAASFLSFRINGDVTPLAKVLDIPARLEARTKLAPETYEAFC
DLRHQAHLQKDFTPKGDASTITPGTYYLEKVNDKFQRSYSVKA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagacctgagaacattggcatcaaggccatcgaaatttacttccccaaccag
tatgtcgagcaaaccgagcttgagacttttgatggcgtcagcgccggcaagtacaccatc
ggccttggccagaccaagatggccttctgcgacgaccgcgaggatatctactccttcgct
ttgaccgtcacctccaacctgatcaagaagtacaacattgacaccaactccattggtcgc
ctcgaagtcggcactgagactctcctggacaagtccaagtctgtcaagactgtgctcatg
cagctcttcggcgagaacaccaacatcgagggtgtcgacaccgtcaacgcctgctacgga
ggtaccaacgccttccttaactctgtcaactggatcgagtcttccgcttgggacggccgt
gatgccattgtcgtcgctggtgacattgccctctacgccaagggcaacgcccgccccact
ggaggcgctggcgcagtcgctatgcttgttggccccaacgctcccgttgttttggagccc
ggtctgcgtggtacctacatgtcccacgtctacgatttctacaagcccgacctcaccagc
gagtacccctacgttgatggtcactactccctgacctgctacaccaaggctctggatgct
gcctaccgcgagtacaacaagcgtgaggccaagctcgccaaggctgccaacggccacgcc
aacggcaacggagccaccaacggagagtccaagatccccaagaccagcctcgacagattc
gactacttctccttccacgcccccaactgcaagctcgttgccaagtcgtacgctcgcctg
ctttaccacgactacctcgccgatgccgactcacccgtcttcgccgaggtcgcccccgag
ctccgcgacatggactacgagaagtcgctgactgacaaggtcgtcgagaagaccttcatg
ggtctcaccaagaagaagtaccaggagagagtcgctcccggtgcccaggtcgccactctc
ctcggcaacatgtactgcggttccgtttggggcggtattgccagcttgctctcctacgtg
gacgctgccactctcaaggacaagcgcgttggtgtcttcagctacggctccggtctggct
gccagcttcctgtctttccgcatcaacggagacgtcactcctctcgctaaggttctcgac
attcccgccagactcgaggcccgcaccaagcttgcccccgagacctacgaggctttctgc
gacctccgtcaccaggctcacctccagaaggacttcacccccaagggtgacgcctccacc
atcacccccggtacatactacctggagaaggtcaacgacaagttccagcgttcctacagc
gtcaaggcatga

DBGET integrated database retrieval system