KEGG   Colletotrichum fioriniae: CFIO01_10534Help
Entry
CFIO01_10534      CDS       T04796                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00450  Selenocompound metabolism
cfj00970  Aminoacyl-tRNA biosynthesis
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFIO01_10534
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFIO01_10534
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfj01007]
    CFIO01_10534
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfj03016]
    CFIO01_10534
Enzymes [BR:cfj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CFIO01_10534
Amino acid related enzymes [BR:cfj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CFIO01_10534
Transfer RNA biogenesis [BR:cfj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CFIO01_10534
 Prokaryotic type
   Other AARSs
    CFIO01_10534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g Acetyltransf_3 tRNA-synt_1 tRNA-synt_1e Acetyltransf_1 FR47 Acetyltransf_7 ESCRT-II
Motif
Other DBs
NCBI-ProteinID: EXF81050
UniProt: A0A010QWR9
AA seq 793 aa AA seqDB search
MRSPWVSPSCTHGQTSRRRFASSDSKGDKPYYVTTPIFYVNASPHVGHMYSMLLADVLKR
WQVLKGRMAILCTGTDEHGSKVQQAAAKQGVPAKEFCDTTAEKFRDLAKAIGMANDHFIR
TTDQDHKEAVQHFWHLLKERGYIYESKHEGWYCVSDECFYGNNEIERRVEPQTGRTIMAA
IESGNEVEWIEEKNYHFRMTALKERLLAFYEANPDWIVPRARQKEVVAWVSNNLEDLSIS
RPVQRLDWGVRVPDDPTQTIYVWVDALINYITKAGFPGWRPGREHEGGWPADVQVIGKDI
VRFHGVYWPALLMALDLPLPKQLLSHAHWTLGKKKMSKSLGNVVNPFFAVDRWGLDTMRY
FMMRDGGIEKDADYENSLVIARYQKDLQSTVGNLMNRVAKSKKWKLRDSVVWAAEKSGGG
APTRHKVEGSEELKVLVDGMAPTMSQHMDELNPNAAIRSVLHVLSEANKYISAAEPWKLA
NSTDPEVQAEKHEVIYYASEAVRSAGILLQPVMPTKMGMLLDMMGVEAGKRRFEHAVFGK
DLTYAIVTPRVTLVPYEARHVEQYHEWMSDPDIQEATASEPLTFEEEYENQQSWRTSHDK
LTFIICQPFDSSSTMASTEAVQAGEVDASERMIGDINFFIYPYDNDDDNEDEEDQAAAAA
AANEGLYVGEVDVMVASKEHRGKGIGHAAVTTLLTYVHRNKARILDEYVQGEEEGKEMTT
KKAAPAQLKGLMVKIKEGNAASIALFRRLGFVQKGEVNYFGEIQMVLGDLDEFVASSAGE
KAADEYREVSYSR
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgccctgggtctccccctcgtgcacccacggacagacatcgcgacgccgattc
gcgagctccgacagcaagggcgacaagccatactacgtgacgacgcccatcttttacgtc
aatgcatcaccccacgtcggccacatgtactcgatgctcctggcagacgttctgaagcgc
tggcaagttctcaagggccggatggcgatcctctgcaccggtacggacgagcacggctcc
aaggtccagcaggcggcggcgaagcaaggcgtgccggccaaggagttctgcgacacgacg
gccgagaagttccgcgacctggcaaaggccatcggcatggccaacgaccacttcatccgc
acgacggaccaggaccacaaggaggcggtgcagcacttttggcacttgctcaaggagagg
ggctacatttacgaatccaaacacgaagggtggtactgcgtcagcgacgagtgcttttac
ggcaacaacgagattgagcggcgggtcgagccgcagacggggcgcaccataatggcggcc
atcgagtctgggaacgaggtggagtggatcgaggagaagaattaccacttccgcatgacg
gcgctcaaggagaggctcctcgccttttacgaggcgaacccggactggatcgtgccgagg
gcgcggcagaaggaggtggtggcgtgggtgtccaacaacctcgaggacctgtccatctcg
cggccggtgcagaggctggactggggcgtgcgggtgccggacgacccgacgcagacgatt
tacgtctgggtcgacgcgctcatcaactacatcacaaaggccgggttccccgggtggcgg
cccggccgcgagcacgagggcgggtggccggcggacgtgcaggtcattggcaaggacatc
gtgcggttccacggcgtgtactggccggcgctgctgatggcgctagacctgccgctgccg
aagcagctgctcagccacgcgcactggacgctggggaagaagaagatgtccaaatcgctg
ggcaacgtggtgaatccgttcttcgcggtcgaccggtggggtctggacacgatgcggtac
tttatgatgcgcgacggcgggatcgagaaggatgcggattatgaaaactcgctcgtcatt
gcaaggtatcagaaggatttgcagtcgactgtggggaacctgatgaaccgggtggccaag
agcaagaagtggaagcttagggattcggtggtgtgggcggcggagaagagcggcggcggt
gcgccgacgaggcacaaggtcgagggcagcgaggagttgaaggtgttggttgacgggatg
gcgccgaccatgtcgcagcacatggacgagctgaatcccaacgccgccattcggagcgtt
ctccacgttctatccgaggcaaacaagtacatctccgccgcggaaccgtggaagctggcc
aactcgacggatcccgaggtccaggccgagaagcacgaggtcatctactacgcgtcggaa
gccgttcgttccgcgggcatcctcctacagccggtgatgccgaccaagatgggtatgctg
cttgacatgatgggcgtcgaggctggtaagcgccgctttgagcatgcggtgtttggcaag
gatttgacgtacgccatcgtgacgccgagggtgactcttgtcccctacgaggcaagacat
gtggagcaatatcatgagtggatgagcgatccggatatccaggaagccacggcctcggag
ccgctcacgttcgaagaggagtacgagaatcagcagtcgtggcgcacctcgcacgacaaa
ctcacctttatcatctgccagccttttgactcgtcgtcgacgatggcgtccaccgaggcc
gtgcaggctggtgaggttgatgcatcggagcggatgattggggatatcaacttcttcatt
tatccctacgacaacgacgatgacaatgaagatgaagaggaccaggctgctgctgctgct
gcggcaaacgaaggcttgtacgtcggcgaggtggacgtcatggtggcgtccaaggagcac
cgcggcaagggcatcggccacgccgccgtgacgacgctgttgacgtacgttcatcgaaac
aaggcgcggatcctcgatgagtatgtccagggagaggaggagggcaaggagatgacgacc
aagaaggcggccccggcgcagctaaagggtttgatggtgaagatcaaggagggcaatgcc
gcgagcattgcgctgtttcggcggttggggttcgtgcagaagggggaggtgaactatttt
ggcgagattcagatggttcttggggacttggacgagtttgtggcgtcttctgctggggag
aaggctgcggatgagtatcgtgaggtctcgtattctagatga

DBGET integrated database retrieval system