KEGG   Colletotrichum fioriniae: CFIO01_11897
Entry
CFIO01_11897      CDS       T04796                                 

Definition
(GenBank) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00910  Nitrogen metabolism
cfj01100  Metabolic pathways
Module
cfj_M00531  Assimilatory nitrate reduction, nitrate => ammonia
cfj_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CFIO01_11897
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     CFIO01_11897
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C Amino_oxidase Pyr_redox_3
Other DBs
NCBI-ProteinID: EXF74795
UniProt: A0A010QDC5
AA seq 1171 aa
MLIPADQACTDFIILWKVLLFPRFSPFGSPSLSECTLPAYHVSLVICIFNMAERKRLVVV
GLGMVGIAFIEKMLKLDARANEYSITVLGEEPHLAYNRVGLTSFFDHRKVENLYLNPEEW
YHSTPQGSLGYHVNTRVTDIDSQAKKVTCSNGEIVPYDILVIATGSDAVLPKHTPGHDAT
GVFVYRTIDDLINLIAFAAQRKGTVGTVVGGGLLGLEAAKAMMDLDCFDKVKLIERNRWV
LSRQLDNDAGSMVVDQVRDLGLDVLLSKRVGKIEVTSDNHVQGVVFEDGERMDCSTICFA
IGVRPRDDLARRAGIKCADRGGGIVVGDDLSTSAPGIYAIGECASWQSQTFGLIAPGVEM
ADVLSFNLTQAKLHQPRLFKRPDLSTKLKLLGVDVASFGDFFADRDGPQYLPPKAAKKAK
KEDEQSTIKTLTNGLPPAPVKALTYRDPFQNVYKKYIFTEDGKYLLGGMMIGDTKDYIKL
VPMVKNMKELDMPPSQLILGAKKEGEDDGDDLTDDTQICSCHNVTKGDVVNNVKDGTCKT
LGEVKACTKAGTGCGGCMPLVTTIFNKTMLSMGNEVKNYLCAHFNYSRADLYNIILVKKL
QTFEDVMREAGNDRNSLGCEACKPTMGSIFASLWNRHVMDKPMHGLQETNDRFLGNIQRN
GTYSVVPRVSAGEITPDKLIAIGNVASKYKLYTKITGGQRIDMFGAKKQDLLDIWRMLVE
AGMESGHAYAKSLRTVKSCVGTTWCRYGVGDSVGMAVRLEERYKSIRAPHKIKGGVSGCV
RECAEAQNKDFGLIATDKGFNIFVAGNGGAKPKHSELLAKDVPPTEVIPIIDRYLMFYIR
TADRLQRTARWLENLPGGIKYLQQVVLEDKLGICASLEAQMQELVDSFFDEWAEAIKNPA
IAAKFKQFDNTEETLDNMEVELDRDQPRPVYWAPESAKEDFKGLKERWSSTTWQPMLPAS
HFFGADETPNGISATVKRGDTQLAVWRVRGRYYATQQMCPHKRQFVLSDGLIGEEPGAAE
TCDDAKKPDSGCNGGPDTNGSGNGNNGAKRPAPWVSCPYHKRNFDLADGSCKNDDEVSIA
TFAVEERAGDGMVYVKLPPVEELDAALGTKKWMVKKGEAGAAPFEALDKKIRFKGHRAKR
PGVKPMGALGMEKARTMVVGGGGGCGSAPDW
NT seq 3516 nt   +upstreamnt  +downstreamnt
atgctgatcccagcggaccaagcttgcactgacttcattatcttgtggaaagtcctactg
tttcctcgcttttctcctttcggttctccttcgctctctgagtgtactcttcctgcttat
cacgtctcgttggtgatttgcattttcaatatggcggaacgaaagagactcgttgttgtc
ggcctgggaatggtcggcatcgccttcattgagaagatgctaaagttggacgcccgcgca
aatgagtacagcatcacggtgctcggagaggagcctcaccttgcatacaaccgcgttggc
cttacaagcttctttgaccaccgaaaagtcgagaatctctacctcaacccagaagaatgg
taccacagcacgcctcaaggctctttgggctaccacgtcaataccagagtcactgatatt
gactcccaagccaaaaaggtgacctgttcgaatggagagatcgtaccgtacgacatttta
gtcattgccacaggctcagatgccgttcttcccaagcacacaccagggcacgacgcaaca
ggcgtattcgtctaccggacgattgacgacctgatcaacctcattgccttcgccgcccaa
aggaaaggcaccgtggggacggttgtcggtggtggtctcctcggtttagaggccgccaag
gcgatgatggacttggactgcttcgacaaggtgaaactgattgagaggaatcggtgggtg
ctgagccggcagctagacaatgatgcggggtccatggtcgtggaccaggtcagggacctc
ggcctcgatgtgctcctcagcaagcgcgtgggcaagattgaggtgacgagcgacaatcac
gtccagggcgtagtctttgaggacggtgagcgtatggactgctccacgatatgtttcgcc
atcggtgtccgaccacgagacgatctagcgcggagagcaggcatcaaatgtgctgatcgc
ggcggcggcatcgttgttggagacgacttaagcaccagcgcaccaggcatatacgccatt
ggggagtgtgcaagctggcaaagtcagacattcggtctcatcgctcccggagtcgagatg
gccgacgtcctgtccttcaatctcacacaggccaagctgcaccagccccggttattcaag
agacccgaccttagcacgaaactaaagcttctgggtgtcgatgttgccagctttggcgat
ttcttcgccgaccgagatggcccgcaatatctgcctcccaaagcggcaaagaaagcgaaa
aaggaagacgagcaaagcaccatcaagaccttgacaaatggcttaccaccggctcctgtc
aaggccctcacataccgcgatccgttccagaatgtgtataagaagtacatttttaccgag
gacggcaagtacttgctgggtggcatgatgatcggtgatacaaaagactacatcaagcta
gtacccatggtcaagaacatgaaggagctggatatgccacctagtcagctcattctcggg
gccaaaaaggagggcgaggacgacggcgacgacttgacggacgacacccagatctgctca
tgtcacaacgtgaccaaaggcgacgtggtcaacaacgtcaaggacgggacctgcaagacg
ctcggcgaggtcaaggcgtgcaccaaggccggcaccggttgcggcggctgcatgcccctc
gtgacgacaatattcaacaagaccatgctgtccatgggcaacgaggtcaagaactatctg
tgcgcccacttcaactactcccgcgccgacctgtacaacatcatcctcgttaagaagctg
cagacctttgaggacgtcatgcgcgaggcgggcaacgaccggaactcgctcggctgcgaa
gcctgcaagcctaccatgggcagcatctttgcctcgttatggaaccgtcacgtcatggac
aagcccatgcacggcctccaggagaccaacgaccgcttcctcggtaacatccagcgcaac
ggcacgtacagcgtcgtcccgcgggtgtctgcgggcgagatcacgcccgacaagctcatc
gccattggcaacgtggcgtccaagtacaagctgtacacgaaaatcactggcggacagcgc
atcgatatgtttggggccaagaagcaggacctcttggatatctggcggatgctggtcgag
gccggtatggagtccgggcatgcgtacgcaaagtcgctgcggacggtcaagagttgtgtg
ggtacgacgtggtgccgatacggcgtcggcgacagtgtgggcatggcggtgcggttggag
gagcggtacaagagcattcgcgcgccgcacaagatcaagggcggcgtcagcgggtgcgtc
cgcgagtgcgccgaagcgcaaaacaaagacttcggcctcatcgccacagacaagggcttc
aacatctttgtggccggcaacggcggcgccaagcccaagcactctgagctgctggccaag
gacgtcccgcccaccgaggttatccccatcatcgaccgctacctcatgttctacatccgc
accgccgacaggcttcagcgcacggcgcgctggctcgagaatctccccggcggcatcaag
tacctccagcaagtcgtcctggaggacaagctcggcatttgcgcctcgctcgaggcccag
atgcaggagctcgtcgacagcttctttgacgagtgggccgaggccatcaagaacccagcc
attgcggccaagttcaagcagtttgacaacacggaggagacgctcgacaatatggaggtc
gagctcgatcgtgatcagccaaggccggtgtactgggcgcccgaatccgcaaaggaggac
ttcaaggggttgaaggagaggtggagcagtacaacttggcagcccatgttgccggcgagt
cactttttcggcgcggacgagacgccgaatggcatctcggcgacggtgaagcgcggggat
acgcagcttgctgtgtggcgggttcggggccggtattatgccacgcagcaaatgtgtcct
cacaagaggcaatttgtgctttccgacgggctcatcggcgaggagcccggtgctgcggag
acgtgcgatgatgcgaagaagcctgattccggatgcaacggcggccccgataccaacggc
agcggtaacggtaataacggggcgaagcggccggcgccgtgggtctcgtgcccgtaccac
aagcgcaactttgacctcgcggacgggagctgcaagaacgacgacgaggtgagcatcgcg
acgttcgcggtggaggaacgcgcgggcgacgggatggtgtatgtgaagctgccccccgta
gaggagctcgacgcggcgctggggacgaagaagtggatggtcaaaaagggggaggccggg
gcggcgccgtttgaggcgctggataagaagattcggttcaaggggcaccgggctaagagg
cctggtgtcaagccgatgggggctttggggatggagaaggcgaggactatggttgttggt
ggtggtggggggtgcgggagtgcgccggattggtga

DBGET integrated database retrieval system