KEGG   Colletotrichum fioriniae: CFIO01_12015Help
Entry
CFIO01_12015      CDS       T04796                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00030  Pentose phosphate pathway
cfj00480  Glutathione metabolism
cfj01100  Metabolic pathways
cfj01110  Biosynthesis of secondary metabolites
cfj01130  Biosynthesis of antibiotics
cfj01200  Carbon metabolism
Module
cfj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cfj_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFIO01_12015
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CFIO01_12015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfj04147]
    CFIO01_12015
Enzymes [BR:cfj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CFIO01_12015
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CFIO01_12015
Exosome [BR:cfj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CFIO01_12015
  Exosomal proteins of colorectal cancer cells
   CFIO01_12015
  Exosomal proteins of bladder cancer cells
   CFIO01_12015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: EXF74389
UniProt: A0A010R9K1
AA seq 507 aa AA seqDB search
MADHTSAAASMELKENTVIVVLGASGDLAKKKTYPALFGLYRNQFLPKDIKIVGYARTKM
DHDDYIRRIRSYMKTPTKEIEQQLNDFCNLCTYVSGQYDKDESFQNLTRHLEELEQGKPE
THRLFYMALPPSVFTIVSQHLKRCCYPTKGIARVVIEKPFGKDLASSRELQKSLEPDWKE
DELYRIDHYLGKEMVKNILILRFGNSFFGSTWNRQNIDNVQITFKEPFGTEGRGGYFDEF
GIIRDVQQNHLLQVLTLLAMERPISFASEDIRDEKVRVLRAMPAIEPKNVIIGQYGKSLD
GSKPSYKEDDTVPKDSRCPTFCALVAYIKNERWDGVPFIMKAGKALNEQKTEIRIQFKDV
TSGIFKDIPRNELVMRIQPNESVYVKMNSKLPGLSMQTVVTELDLTYRRRFSDLKIPEAY
ESLILDCLKGDHSNFVRDDELDASWRIFTPLLHYLDDNKEIIPMEYPYGSRGPAVLDDFT
SSYGYKFSDAAGYQWPTTSAQAAPNKL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcacacctccgccgcagcttctatggagctcaaggagaacaccgtcatcgtt
gttctcggtgcttccggagatttggcaaagaagaagacttaccctgctctgttcggtctg
taccgaaaccagttcctccccaaggacatcaagattgtcggatatgcgcggacaaagatg
gaccacgatgactacatccgccgcatcagatcctacatgaagacacccacaaaggagatt
gagcagcagctcaacgacttctgcaacctctgcacctacgtttctggccagtacgacaag
gacgagtcattccagaacctgaccaggcacctcgaggagctcgagcagggcaagcctgag
actcaccgtctcttctatatggccctcccccccagtgtcttcaccattgtctcccagcac
ctcaagagatgctgctaccccaccaagggaattgcgcgcgttgtcattgagaagcccttt
ggtaaggatcttgccagctcccgggagcttcaaaagtcccttgagcccgactggaaggaa
gatgagctttaccgcattgaccactacctcggcaaggagatggtgaagaacatccttatc
cttcgctttggtaactctttcttcggctctacctggaacaggcagaacatcgacaacgtt
cagattaccttcaaggagccttttggcaccgaaggtcgcggcggttactttgacgagttc
ggtatcattcgcgatgttcagcagaaccacttgctccaggtcctcaccctgctcgctatg
gagcgccccatttccttcgcctcggaggacattcgtgacgagaaggtgcgcgttctccgt
gccatgcccgccatcgagcccaagaacgtcattatcggacaatacggcaagtcattggac
ggcagcaaaccttcgtacaaggaagacgatactgttcccaaggactcgaggtgtcccact
ttctgcgccctcgtcgcgtacatcaagaacgagcgctgggatggcgttcctttcatcatg
aaggccggcaaggccctcaacgagcagaagactgagattcgtattcagttcaaggacgtt
acctcgggcatctttaaggacattccccgcaacgagcttgtcatgcgcattcagcccaac
gagagcgtttacgtcaagatgaactccaagctgcccggtctcagcatgcagactgtcgtc
accgagcttgacttaacctaccgccgccgcttctctgacctcaagatccccgaggcttac
gagtcattgattctggactgcctgaagggcgaccactccaacttcgtccgtgacgacgag
ctggacgccagctggagaatcttcacccctctgctgcactacctggacgacaacaaggag
atcatccccatggagtacccctatggatctcgtggccccgctgtcctcgacgacttcacc
tcttcctatggctacaagttcagtgatgcggctggataccagtggcctacgacctctgct
caggctgccccgaacaagttgtga

DBGET integrated database retrieval system