KEGG   Corynebacterium frankenforstense: CFRA_00740Help
Entry
CFRA_00740        CDS       T04872                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfk  Corynebacterium frankenforstense
Pathway
cfk00071  Fatty acid degradation
cfk00280  Valine, leucine and isoleucine degradation
cfk00310  Lysine degradation
cfk00362  Benzoate degradation
cfk00380  Tryptophan metabolism
cfk00620  Pyruvate metabolism
cfk00630  Glyoxylate and dicarboxylate metabolism
cfk00640  Propanoate metabolism
cfk00650  Butanoate metabolism
cfk00900  Terpenoid backbone biosynthesis
cfk01100  Metabolic pathways
cfk01110  Biosynthesis of secondary metabolites
cfk01120  Microbial metabolism in diverse environments
cfk01130  Biosynthesis of antibiotics
cfk01200  Carbon metabolism
cfk01212  Fatty acid metabolism
cfk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFRA_00740
   00630 Glyoxylate and dicarboxylate metabolism
    CFRA_00740
   00640 Propanoate metabolism
    CFRA_00740
   00650 Butanoate metabolism
    CFRA_00740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFRA_00740
   00072 Synthesis and degradation of ketone bodies
    CFRA_00740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFRA_00740
   00310 Lysine degradation
    CFRA_00740
   00380 Tryptophan metabolism
    CFRA_00740
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFRA_00740
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFRA_00740
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFRA_00740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfk04147]
    CFRA_00740
Enzymes [BR:cfk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFRA_00740
Exosome [BR:cfk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFRA_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt LysR_substrate
Motif
Other DBs
NCBI-ProteinID: APT88066
UniProt: A0A1L7CQE3
Position
173196..174494
Genome map
AA seq 432 aa AA seqDB search
MTTSTRRVAVLGGNRIPFARSNREYADASNQDMLTAAIDGLVARYGLQDERLGMVVAGAV
LKHSRDFNLTRECVLGSALSSQTPAMDVQQACGTGLAAAVSVADAIARGRIEAGLAGGVD
TTSDAPLAVGDELRRTLIKLTTAKSTADKLKLVGSIRPKQLAPEQPQNGEPRTGLSMGEH
AAITAREFGITRQTQDELAVASHRNLAAAYEAGFFSDLLTPFLGVQRDTNLRPDSDTEKL
AKLKPVFGKKDAERHGAQATMTAGNSTPLTDGASVALLASEEWAEQHNIPVRAYLVDTEI
AAVDFVHGPDGLLMAPTYAVPRMLERNGLSLQDFDFYEIHEAFASQVLATLAAWESDEYC
RGRLGLEGALGSIDRAKLNVKGSSLAAGHPFAATGGRILATAAKTLEENGGGRTLVSICA
AGGQGIVAILER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctccacccgccgcgtcgccgtcctcggcggcaaccgcatccccttcgcgcgc
tccaaccgcgagtacgccgacgcctccaaccaggacatgctcacggccgccatcgacggg
ctcgtcgcccgctacggcctgcaggacgagcgcctcggcatggtcgtcgcgggcgccgtg
ctcaagcactcccgcgacttcaacctcacccgcgagtgcgtgctcggctccgcgctgagc
tcgcagaccccggccatggacgtccagcaggcctgcggcaccggcctggccgccgcggtc
tccgtggcggacgcgatcgcccgcggccgcatcgaggccggcctggccggcggtgtggac
accacctcggacgccccgctggccgtcggcgacgaactgcgccgcaccctgatcaagctg
accaccgccaagtccaccgcggacaagctcaagctcgtcggctcgatccgcccgaagcag
ctggcgcccgagcagccgcagaacggcgagccgcgcaccgggctgtcgatgggcgagcac
gccgcgatcaccgcccgtgagttcggcatcacccgccagacccaggacgagctggccgtc
gcctcgcaccgcaacctcgccgccgcctacgaggccgggttcttctccgacctgctcacc
ccgttcctcggcgtgcagcgcgacaccaacctgcgcccggactccgacacggagaagctg
gccaagctcaagccggtcttcggcaagaaggacgccgagcgccacggcgcgcaggcgacc
atgaccgccggcaactccaccccgctgaccgacggcgcctcggtggccctgctggccagc
gaggagtgggcggagcagcacaacatcccggtgcgcgcctatctggtcgacaccgagatc
gccgcggtcgacttcgtccacggcccggacggcctgctgatggccccgacctacgccgtg
ccgcgcatgctcgagcgcaacggcctgagcctgcaggacttcgacttctacgagatccac
gaggccttcgcctcccaggtcctggccaccctggccgcctgggagtccgacgagtactgc
cgcgggcgcctgggtctcgagggcgcgctgggctccatcgaccgcgcgaagctcaacgtc
aagggctcctcgctggccgccggccaccccttcgccgccaccggcgggcgcatcctggcc
accgccgcgaagacgctcgaggagaacggcggcggccgcactctggtcagcatctgcgcc
gccggcggccagggcatcgtcgccatcctggagcgctga

DBGET integrated database retrieval system