KEGG   Corynebacterium frankenforstense: CFRA_02510Help
Entry
CFRA_02510        CDS       T04872                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cfk  Corynebacterium frankenforstense
Brite
KEGG Orthology (KO) [BR:cfk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CFRA_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APT88331
UniProt: A0A1L7CR86
Position
571462..573078
Genome map
AA seq 538 aa AA seqDB search
MTASPTTQTKKGGESLASQANDWGWHLTFGAIFAVTIIIFTLWSFDFVGDGASRIVLITA
IAFAMFMAFNIGGNDVANSFGTSVGAGTLSLKQALVVAAIFEVSGAVLAGGEVTDTVRSG
IVDLDAIQGLDASEFLYIMMAALLGAAIWLLVATRLGWPVSTTHSIVGGIVGAALTVGFI
TGKGGWSMVQWSEIGTIAISWVLSPVLGGVVAWVLFRSIKNSILVYNERADSRLRDIKVE
RAELKTRHKNAFERLSEIQQISYTNAMVRDSTTYSDPDHDPEELESDYYRELDRIDREAD
DVDAHHALEVWVPLLAAGGSVIISAMMLFKGLKNLNLSLSNFGNFLIMGMIAAVVWMAVF
IFARSLKRQDLSRSTFLLFSWMQVFTASAFAFSHGSNDIANAIGPFIAVLDVLKTNEISS
ESSVPLAVMVAMGIALIAGLWFVGRYVIKTVGSGLTEMHPASGFSAELSAAAVVMTSSLL
GLPVSSTHILIGAVLGVGIVNKAANWNLMKPIAAAWVVTLPASAVVAAVTVSILRVVF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatcaccaacgactcagacgaaaaagggcggtgaatcgctcgcgtcccaggcc
aacgactggggctggcacctgaccttcggcgccatcttcgcggtcaccatcatcatcttc
acgctgtggtctttcgacttcgtcggcgacggcgccagccgcatcgtcctgatcaccgcc
atcgccttcgccatgttcatggcgttcaacatcggcggcaacgacgtggccaactccttc
ggcacctccgtcggcgccggcacgctctcactgaagcaggcgctcgtcgtcgccgcgatc
ttcgaggtcagcggcgccgtgctcgccggcggcgaggtcaccgacaccgtgcggtccggc
atcgtcgacctcgacgccatccagggcctggacgcctcggagttcctctacatcatgatg
gccgccctgctcggcgccgccatctggctgctcgtggccacccgcctcggctggcccgtg
tccaccacgcactccatcgtcggcggcatcgtcggcgccgccctgaccgtcggcttcatc
accggcaagggcggctggtcgatggtccagtggagcgagatcggcaccatcgccatctcc
tgggtgctctccccggtgctcggcggcgtggtcgcctgggtgctcttccgcagcatcaag
aactcgatcctcgtctacaacgagcgcgccgactcccgcctgcgcgacatcaaggtcgag
cgcgccgagctgaagacccgccacaagaacgccttcgagcgcctcagcgagatccagcag
atctcctacaccaacgcgatggtccgcgactcgacgacctactccgacccggaccacgac
cccgaggagctcgagtccgactactaccgcgagctcgaccgcatcgaccgcgaggccgac
gacgtcgacgcccaccacgccctcgaggtgtgggtgccgctgctggcggccggcggctcg
gtcatcatctccgcgatgatgctgttcaagggcctgaagaacctgaacctgtccctgtcg
aacttcggcaacttcctcatcatgggcatgatcgccgccgtggtgtggatggccgtgttc
atcttcgcgcgctccctgaagcgccaggacctgtcgcgctcgacgttcctgctgttcagc
tggatgcaggtcttcaccgcctcggccttcgccttctcgcacggctccaacgacatcgcc
aacgcgatcgggccgttcatcgccgtgctcgacgtgctcaagaccaacgagatctcctcc
gagtcctcggtgccgctggccgtcatggtcgcgatgggcatcgccctgatcgccggcctg
tggttcgtcggccgctacgtcatcaagaccgtcggcagcgggttgaccgagatgcacccg
gccagcggcttctccgcggagctgtccgcggccgccgtggtcatgacgtcctcgctgctg
ggtctgccggtctcctcgacccacatcctcatcggcgcggtgctcggcgtgggcatcgtc
aacaaggccgcgaactggaacctgatgaagccgatcgccgccgcctgggtggtcaccctg
ccggcgtccgcggtcgtcgcggccgtcacggtctccattctgcgcgtcgtgttctga

DBGET integrated database retrieval system