KEGG   Corynebacterium frankenforstense: CFRA_03670Help
Entry
CFRA_03670        CDS       T04872                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cfk  Corynebacterium frankenforstense
Pathway
cfk00450  Selenocompound metabolism
cfk00970  Aminoacyl-tRNA biosynthesis
cfk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CFRA_03670
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CFRA_03670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfk01007]
    CFRA_03670
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfk03016]
    CFRA_03670
Enzymes [BR:cfk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CFRA_03670
Amino acid related enzymes [BR:cfk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CFRA_03670
Transfer RNA biogenesis [BR:cfk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CFRA_03670
 Prokaryotic type
   Other AARSs
    CFRA_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APT88523
UniProt: A0A1L7CRQ0
Position
830459..832291
Genome map
AA seq 610 aa AA seqDB search
MNDTVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMRGADVLMISGTDEHGTPLLVQ
ADKEGVSVQELADRYNRQIVEDLAGLGLSYDLFTRTSTRNHYAVVQELFRGLLDNGYMIR
QKTLGAVSPSTGRTLPDRYIEGTCPICGADGARGDQCDNCGNQLDPVDLIKPVSKINGEA
PEFVETEHFLLDLPALAGALEKWLKTRDSWRPNVLKFSLNLLGDLHPRAMTRDIDWGIPV
PVEGWQDNNAKKLYVWFDAVVGYLSASIEWAWRSGDPEAWKKWWQDPEATSYYFMGKDNI
TFHSQIWPGELLGYAGKGDKGGEVHRYGELNLPTEVVSSEFLTMSGSKFSSSKGVVIYVK
DFLREFGPDPLRYFIAVAGPENNDTDFTWDEFVRRINNELANGWGNLVNRTVSMAHKNFG
QVPAPAALEAADEEILGLAERTFDEAGELLAQSKFKAAITAVMHVVGEANAYIADQEPWK
LAKDESARERLATVLWTALQVVSDCNTMLTPFLPHTAQAVHETLGRSGVWAAEPRVEEVT
DDMPVDLVGVGLPEEGRTYPVIMGDYAEEKARWARVDVEPGTPLAKPKPLIAKLDPELAE
TGPEWAPVAE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacactgtgcttgtctcggttgcctggccctacgccaacggcccgcgccacatc
ggtcacgtggccggcttcggcgtcccctcggacgtcttcgcccgctaccagcgaatgcgt
ggcgcggacgtgctgatgatctccggcaccgacgagcacggcaccccgctgctcgtccag
gcggacaaggagggcgtcagcgtccaggagctggcggaccgctacaaccgccagatcgtc
gaggacctcgcgggcctcggcctctcctacgacctgttcacccgtaccagcacccgcaac
cactacgcggtggtccaggagctcttccgcggcctgctggacaacgggtacatgatccgc
cagaagaccctcggcgccgtctcgccgtcgaccgggcgcaccctgccggaccgctacatc
gagggcacctgcccgatctgcggagccgacggcgcgcgcggcgaccagtgcgacaactgc
ggcaaccagctcgaccccgtggacctgatcaagccggtgagcaagatcaacggcgaggcc
ccggagttcgtcgagaccgagcacttcctgctcgacctgcccgcgctggccggcgccctg
gagaagtggctcaagacccgcgactcctggcgccccaacgtgctgaagttctcgctgaac
ctcctcggcgacctgcacccgcgcgcgatgacccgcgacatcgactggggcatcccggtg
ccggtcgagggctggcaggacaacaacgccaagaagctctacgtctggttcgacgccgtc
gtcggctacctctccgcctccatcgagtgggcctggcgcagcggcgaccccgaggcctgg
aagaagtggtggcaggacccggaggccaccagctactacttcatgggcaaggacaacatc
accttccactcccagatctggcccggcgagctcctcggctacgccggcaagggcgacaag
ggcggcgaggtccaccgctacggcgagctgaacctgcccaccgaggtcgtctcctccgag
ttcctgacgatgtccggctcgaagttctcctcctccaagggcgtggtcatctacgtcaag
gacttcctgcgcgagttcggcccggacccgctgcgctacttcatcgcggtggccggcccg
gagaacaacgacaccgacttcacctgggacgagttcgtccgccgcatcaacaacgagctg
gccaacggctggggcaacctggtcaaccgcaccgtgtcgatggcgcacaagaacttcggc
caggtgcccgccccggccgcgctcgaggccgccgacgaggagatcctcggcctggccgag
cgcaccttcgacgaggccggcgagctgctcgcccagtcgaagttcaaggccgccatcacc
gccgtgatgcacgtcgtcggcgaggccaacgcctacatcgccgaccaggagccctggaag
ctggcgaaggacgagtccgcccgcgagcgcctggccaccgtgctgtggaccgcgctgcag
gtcgtcagcgactgcaacacgatgctcaccccgttcctgccgcacaccgcccaggccgtc
cacgagaccctcggccgctccggcgtgtgggccgccgagccgcgcgtcgaggaggtcacc
gacgacatgccggtcgacctcgtcggcgtcggcctgccggaggaggggcgcacctacccg
gtgatcatgggcgactacgccgaggagaaggcccgctgggcccgcgtcgacgtcgagccg
ggcaccccgctggccaagccgaagcccctgatcgccaagctcgaccccgagctcgccgag
accggacctgaatgggctcccgtcgccgagtag

DBGET integrated database retrieval system