KEGG   Corynebacterium frankenforstense: CFRA_05060Help
Entry
CFRA_05060        CDS       T04872                                 

Definition
(GenBank) peroxidase
  KO
K15733  dye decolorizing peroxidase [EC:1.11.1.19]
Organism
cfk  Corynebacterium frankenforstense
Brite
KEGG Orthology (KO) [BR:cfk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFRA_05060
Enzymes [BR:cfk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.19  dye decolorizing peroxidase
     CFRA_05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dyp_perox TAT_signal
Motif
Other DBs
NCBI-ProteinID: APT88723
UniProt: A0A1L7CSA2
Position
1136858..1138120
Genome map
AA seq 420 aa AA seqDB search
MHRLSRRGFLGAGVGTVGAAAVACATPGGGEAAKGGQGDEATDAQGADAAPLAGQTVAFD
GPHQAGVQTASQANLALISFDLNEGVDRAGVRRLMNLWTEDARALCGGKNPVGGLEPEMV
QTPANLTITVGFGEPLFDKIGLPDQRPGFLHDIPAFEHDDLDPRWGQTDLVLQICGDDAI
SVAYAMRHMIRSGVDYAHTRWFQRGLSHADGSMADGTTPRNLFGQKDGTVNPHGDEEYDQ
QVWIDAAADGAPDWLDGGSVMVARRIAMHMDEWEKLDRNSREVVIGRDLPEGAPLSGGDE
FTEPDLTKTDETGLPVIDPKSHMALSRDDEKYDAEQRLLRRPYTYDLEPEPGSGDASNSG
LVFLCYQRNPDKQFSAIQRRLDGGDRLNEWITHIGSSVYALPPGVGEDGDSYWGQRLLEA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atccaccgcctctcgcgccgcgggttcctcggcgccggcgtcggcaccgtcggcgccgcc
gccgtggcctgcgccacccccggcgggggcgaggccgccaagggtggccagggggatgag
gcgaccgacgcgcagggtgcggacgccgccccgctggccggtcagacggtggccttcgac
gggccccaccaggccggcgtgcagaccgcctcgcaggcgaacctggcgctgatctccttc
gacctcaacgagggcgtggaccgcgccggggtgcgccggctgatgaacctgtggaccgag
gacgcccgcgcgctgtgcggcgggaaaaacccggtcggcgggctcgagccggagatggtg
cagaccccggcgaacctgacgatcacggtcggcttcggcgagccgctcttcgacaagatc
ggcctgcccgaccagcgccccgggttcctgcacgacatccccgccttcgagcacgacgac
ctggacccgcgctggggtcagaccgacctggtgctccagatctgcggcgacgacgcgatc
tcggtggcctacgcgatgcgccacatgatccgctccggcgtggactacgcccacacccgc
tggttccagcgcgggctcagccacgccgacggctcgatggccgacggcaccaccccgcgc
aacctcttcggccagaaggacggcaccgtcaacccgcacggtgacgaggagtacgaccag
caggtctggatcgacgccgccgccgacggcgcgcccgactggctcgacggcggcagcgtg
atggtcgcccgccgcatcgccatgcacatggacgagtgggagaagctcgaccgcaactcc
cgcgaggtcgtcatcggccgcgacctgcccgagggcgcgccgctgtccggcggcgacgag
ttcaccgaaccggacctgaccaagaccgacgagacgggtcttccggtcatcgacccgaag
agccacatggcgctctcccgcgacgacgagaaatacgacgccgagcagcgcctgctgcgc
cggccctacacctacgacctcgagccggaaccgggaagcggcgacgcctcgaactccggg
ctggtcttcctgtgctaccagcgcaacccggacaagcagttcagcgcgatccagcgccgc
ctcgacggcggcgaccgcctcaacgagtggatcacccacatcggctcctcggtctacgcc
ctgccgccgggcgtcggcgaggacggcgacagctactggggccagcgcctgctcgaggcc
tag

DBGET integrated database retrieval system