KEGG   Corynebacterium frankenforstense: CFRA_08735Help
Entry
CFRA_08735        CDS       T04872                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cfk  Corynebacterium frankenforstense
Pathway
cfk00061  Fatty acid biosynthesis
cfk00071  Fatty acid degradation
cfk01100  Metabolic pathways
cfk01212  Fatty acid metabolism
cfk02024  Quorum sensing
Module
cfk_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cfk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CFRA_08735
   00071 Fatty acid degradation
    CFRA_08735
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CFRA_08735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cfk01004]
    CFRA_08735
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfk04147]
    CFRA_08735
Enzymes [BR:cfk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CFRA_08735
Lipid biosynthesis proteins [BR:cfk01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CFRA_08735
Exosome [BR:cfk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CFRA_08735
  Exosomal proteins of breast cancer cells
   CFRA_08735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: APT89319
UniProt: A0A1L7CU23
Position
complement(1963311..1965155)
Genome map
AA seq 614 aa AA seqDB search
MASAGREFSTPAEFEVGPNETVLTAFIDQVRDRPYGISFLRPHNYEWVNVTSEEFLEEIF
EVAKGLIANGVEPGDRVILLAATRYEWSLLDFAISAAGAVLVPIYPSSSAAQIQWIVEDS
GAVFAVTETGEHTDMMRNLVLDSEGNPRLVDSPTQLRRIVEINSAGVDTLKFEGRGLEDA
VVWERIENTRSSDVASIVYTSGTTGRPKGCVQTHYNWLSQVRALLTNPIAANAVAPGKSV
LTYLPLAHVLARAVSLACVVVGCLQSHWPDTHTLQVQLARFRPNLLLGVPRVFEKVRNAA
ASQAAEKGPVGRAIFARAEQAAIEYSKAMDTPAGPNRYQEAQHRLYHKLVYKKIHEAVGG
RVEYCITGGSPMGSELLHFFRGIGLGVFEGYGLTETCAAASVDFEDQKIGSVGRPLGGGS
VKINDIGEILFKGPWVFKEYWKNPEATEKSFEDGWYNTGDLGEIDEDGYIFITGRKKDLI
VTAGGKNVSPAPLEDMLRSHPLISQALVVGDGKPFIGVLLTLDDEELGRWKMDHNIPEHR
SVREVAADPALRAEIQDAINQANLTVSHAEGIKKFYILDRDLTEEQNELTPTLKVKRNVV
TERYADAIDKIYRR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtccgcggggcgtgagttctccaccccggccgaattcgaggtcgggccgaacgag
accgtcctgaccgcgttcatcgaccaggtccgtgaccgcccctacggcatcagcttcctg
cgtccgcacaactacgagtgggtcaacgtcacctccgaggagttcctcgaggagatcttc
gaggtggccaaggggcttatcgccaacggcgtggagcccggcgaccgcgtgatcctgctg
gccgccacccgctacgagtggtcgctgctggacttcgccatctcggccgccggcgccgtg
ctcgtgccgatctacccgtcctcctcggccgcgcagatccagtggatcgtcgaggactcc
ggcgccgtcttcgccgtcaccgagaccggcgagcacaccgacatgatgcgcaacctcgtc
ctcgactccgagggcaacccgcgcctggtggactcgccgacgcagctgcgccgcatcgtg
gagatcaactccgccggcgtggacaccctcaagttcgagggccgcggcctcgaggacgcc
gtggtctgggagcgcatcgagaacacccgctcctccgacgtcgcctcgatcgtctacacc
tccggcaccaccgggcgccccaagggctgcgtgcagacccactacaactggctctcccag
gtgcgcgccctgctgaccaacccgatcgccgccaacgccgtggccccgggcaagtccgtg
ctgacctacctgccgctggcgcacgtgctcgcgcgcgcggtctccctggcctgcgtggtc
gtcggctgcctgcagtcgcactggccggacacccacaccctgcaggtccagctggcccgc
ttccggccgaacctgctgctcggtgtcccgcgcgtcttcgagaaggtgcgcaacgccgcc
gcctcccaggccgcggagaagggccccgtcgggcgtgcgatcttcgcccgcgccgagcag
gccgccatcgagtactccaaggccatggacaccccggcgggccccaaccgctaccaggag
gcccagcaccgcctgtaccacaagctcgtctacaagaagatccacgaggccgtcggcggc
cgcgtggagtactgcatcaccggcggctcgccgatgggcagcgagctgctgcacttcttc
cgcggcatcggcctcggcgtcttcgagggctacggcctgaccgagacctgcgcggccgcc
tccgtcgacttcgaggaccagaagatcggctccgtgggccgcccgctcggcggtggctcg
gtcaagatcaacgacatcggcgagatcctcttcaagggcccctgggtcttcaaggagtac
tggaagaacccggaggccacggagaaatccttcgaggacggctggtacaacaccggcgac
ctcggtgagatcgacgaggacggctacatcttcatcaccggccgcaagaaggacctcatc
gtcaccgccggcggcaagaacgtctccccggcgccgctcgaggacatgctgcgctcccac
ccgctgatcagccaggcgctcgtggtcggcgacggcaagcccttcatcggcgtgctgctc
accctcgacgacgaggagctgggccgctggaagatggaccacaacatccctgagcaccgc
tcggtgcgcgaggtcgccgccgacccggcgctgcgcgcggagatccaggacgccatcaac
caggcgaacctgaccgtctcccacgccgagggcatcaagaagttctacatcctcgaccgc
gacctgaccgaggagcagaacgagctgaccccgacgctgaaggtcaagcgcaacgtggtc
accgagcgctacgcggacgcgatcgacaagatctaccgccgctag

DBGET integrated database retrieval system