KEGG   Cellulomonas flavigena: Cfla_0106Help
Entry
Cfla_0106         CDS       T01230                                 

Definition
(GenBank) Methylenetetrahydrofolate reductase (NAD(P)H)
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00670  One carbon pool by folate
cfl01100  Metabolic pathways
cfl01120  Microbial metabolism in diverse environments
cfl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Cfla_0106
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Cfla_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ADG73026
UniProt: D5UFR7
Position
complement(130689..131768)
Genome map
AA seq 359 aa AA seqDB search
MSVVAETGTVPAAPSAPGRARAARRRAEQAGALDRPTVSFEFFPPRNPDAAPRLWETVRA
VETVEPDFVSVTYGASGKTRETTRAFVRRLLRETSLNPIAHLTCVGTSRTEVSTIVEEFL
DEGVRSFLALRGDPPVGQPDWRPHPEGVHTAAELVELLRDLEQRRCGRSPAQAVRARVRP
LSVAVAAFPRGNHATGGTRAQDVQALLAKQEAGADFAISQLFYDAEAYLGLVAEARQAGV
TIPIVPGIIPTTDPARLLRVQELSGVPVPRHLLDLLGSTDDPVERHRRGTQAGVDLVNAV
LDGGAPGVHVYTFNKHEAALDLLDGADLLDGRRCAVTPHDPSGGTPAGATATTPRGNLS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgtggccgagaccgggaccgtccccgccgcaccgagcgcgccgggtcgcgca
cgcgccgcgcgccgtcgtgccgagcaggccggcgccctggaccgtccgaccgtctccttc
gagttcttccccccgcgcaaccccgacgcggcgccgcgcctgtgggagaccgtgcgcgcc
gtcgagaccgtcgagcccgacttcgtctcggtgacgtacggcgcctccggcaagacgcgc
gagaccacgcgcgcgttcgtgcgccggctgctgcgcgagacctcgctcaacccgatcgcc
cacctcacctgcgtcgggacgtcgcggaccgaggtctccacgatcgtcgaggagttcctc
gacgagggcgtgcgctccttcctcgcgctgcgcggcgacccgcccgtgggccagccggac
tggcgaccccaccccgagggtgtccacaccgccgccgagctcgtcgagctcctgcgcgac
ctcgagcagcgccggtgcggccgcagccctgcgcaggccgtccgcgcccgggtgcgcccc
ctgtcggtggccgtcgccgcgttcccgcgcggcaaccacgccaccggcggcacgcgcgcc
caggacgtccaggccctgctcgccaagcaggaggccggggccgacttcgcgatctcgcag
ctcttctacgacgccgaggcgtacctgggtctcgtcgccgaggcccggcaggcgggcgtg
acgatcccgatcgtgccgggcatcatcccgaccaccgaccctgcacggctgctgcgcgtc
caggagctctccggcgtccccgtgccgcggcacctgctcgacctgctgggctccaccgac
gacccggtcgagcgccaccgccgcggcacgcaggcaggcgtcgacctggtcaacgccgtc
ctcgacggcggcgcccccggcgtccacgtctacaccttcaacaagcacgaggcggcgctc
gacctgctcgacggcgccgacctgctcgacggccgccgctgtgccgtcaccccgcacgac
ccgtccggcggcacccccgccggagcgaccgccacgacaccgcgaggaaacctgtcatga

DBGET integrated database retrieval system