KEGG   Cellulomonas flavigena: Cfla_0654Help
Entry
Cfla_0654         CDS       T01230                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00010  Glycolysis / Gluconeogenesis
cfl00260  Glycine, serine and threonine metabolism
cfl00680  Methane metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
cfl01230  Biosynthesis of amino acids
Module
cfl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_0654
  Energy metabolism
   00680 Methane metabolism
    Cfla_0654
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_0654
Enzymes [BR:cfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cfla_0654
Membrane trafficking [BR:cfl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cfla_0654
Exosome [BR:cfl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cfla_0654
  Exosomal proteins of melanoma cells
   Cfla_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADG73566
UniProt: D5UJ43
Position
709969..710709
Genome map
AA seq 246 aa AA seqDB search
MTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGIEEAKRGGTLLTDAGVLPDVVHTSLLR
RAITTANLALDAADRHWIPVKRSWRLNERHYGALQGKNKKETLDAYGEEQFMLWRRSYDV
PPPEIELGSEYSQDADPRYAGEPIPRTEALAQVLDRALPYWDAEIVPDLKAGKVVLVAAH
GNSIRSIVKYLDDVDEQTIAGINIPTGIPLLYELDEETLKPTNPGGTYLDPEAAKAAIAA
VANQGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccctcgtgctgctccgccacggcgagagcgagtggaacgccaagaacctg
ttcaccggctgggtggacgtgcccctgtccgagaagggcatcgaggaggccaagcgcggc
gggacgctcctgaccgacgcgggcgtgctccccgacgtcgtgcacacgtcgctgctgcgc
cgcgcgatcacgaccgcgaacctcgcgctcgacgccgcggaccggcactggatccccgtg
aagcgctcgtggcgcctcaacgagcggcactacggcgcgctgcagggcaagaacaagaag
gagacgctcgacgcgtacggcgaggagcagttcatgctctggcgccgctcgtacgacgtc
ccgccgccggagatcgagctcggctcggagtactcccaggacgccgacccgcgctacgcg
ggcgagccgatcccgcgcaccgaggcgctcgcgcaggtcctcgaccgcgcgctgccctac
tgggacgccgagatcgtgcccgacctcaaggccggcaaggtcgtcctcgtcgccgcgcac
ggcaactcgatccgctcgatcgtcaagtacctcgacgacgtggacgagcagaccatcgcg
ggcatcaacatccccacgggcatcccgctgctgtacgagctggacgaggagacgctgaag
ccgacgaaccccggcggcacgtacctcgacccggaggccgccaaggccgcgatcgccgcg
gtggcgaaccagggtcgctga

DBGET integrated database retrieval system