KEGG   Cellulomonas flavigena: Cfla_0842Help
Entry
Cfla_0842         CDS       T01230                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00511  Other glycan degradation
cfl00520  Amino sugar and nucleotide sugar metabolism
cfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cfla_0842
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cfla_0842
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cfla_0842
Chaperones and folding catalysts [BR:cfl03110]
 Intramolecular chaperones
  Others
   Cfla_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ADG73752
UniProt: D5UK10
Position
916037..917506
Genome map
AA seq 489 aa AA seqDB search
MSDVLGIVPAPLVVEPASQPPFVITRSTVVVVDADEELLPLAVLTADLLGRLTGRAVEIR
HAEAGSPGVVRMRLAEDVLPGVEAYRVVVGSGRVLLEARSTEGLVHAVVTLRQLLRERPD
GSVEVEAVRVEDAPRYPWRGLSVDVARHFVSVPDLKVVIGLMGHYKLNVLHLHLTDDQGW
RLDMPSRPELVRRSAARSVDGDPGGYYSAADWDGILAFARARGIRVVPEIDVPGHVNAAL
HAYSELNPDGEPAEEYLGTEVGFSRLYDDLPATHAFLADVLGDLAEMTPGAYVHIGGDEV
LTMEHAEYVRLVRAASAAVTAHGKRVVGWQEIAAVPDLPAGTVVQYWDMRVDPEPFVAAA
AAGARILLSPGAKVYLDMRYEPGFPLGQEWAGTVDLRDAYEWEPATLVEGLPPEAVVGVG
AAVWTETLRTLDDLTTMLLPRLAAVAEVAWSAPARRDFDDFAERLRSHGRHWDRMGLAWH
PSRQGRWDG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgtcctcgggatcgtgcccgcgccgctcgtcgtcgagccggcgtcgcagccg
ccgttcgtcatcacccgctcgaccgtcgtcgtcgtcgacgccgacgaggagctgttgccg
ctggcggtgctcacggccgacctgctgggcaggctcaccgggcgggcggtcgagatccgg
cacgccgaggccggcagcccgggcgtggtgcggatgcggctcgccgaggacgtgctgccc
ggggtcgaggcgtaccgcgtcgtggtcggctcgggcagggtgctgctcgaggcgcgcagc
acggaggggctggtccacgccgtcgtcacgctgcgccagctgctgcgcgagcggcccgac
ggctccgtcgaggtcgaggccgtgcgcgtcgaggacgccccgcggtacccgtggcgcggg
ctgtccgtcgacgtcgcacgccacttcgtcagcgtgccggacctcaaggtcgtcatcggc
ctcatggggcactacaagctcaacgtgctgcacctgcacctcacggacgaccaggggtgg
cggctcgacatgccgtcgcggcccgagctggtgcggcgctcggccgcgcgctcggtggac
ggtgacccggggggctactactcggcggcggactgggacgggatcctcgcgttcgcgcgg
gcccgcggcatccgcgtcgtgccggagatcgacgtgccggggcacgtcaacgccgccctg
cacgcctacagcgagctcaaccccgacggggagcccgccgaggagtacctcggcaccgag
gtcgggttctcccgcctgtacgacgacctgcctgcgacgcacgcgttcctcgccgacgtc
ctcggggacctcgccgagatgacgccgggcgcctacgtgcacatcggcggtgatgaggtc
ctcacgatggagcacgccgagtacgtgcggctcgtgcgggcggcgtcggccgcggtcacg
gcgcacggcaagcgcgtcgtcgggtggcaggagatcgcggccgtgccggatctgccggcc
ggcacggtggtccagtactgggacatgcgcgtggaccccgagccgttcgtcgcggcggct
gcggccggcgcgcggatcctgctgtcgccgggcgcgaaggtctacctcgacatgcggtac
gagccgggcttcccgctggggcaggagtgggcgggcacggtggacctgcgcgacgcctac
gagtgggagcctgcgaccctcgtcgaggggctgcctcccgaggccgtcgtcggtgtgggg
gcggccgtgtggaccgagacgctgcggacgctcgacgacctgacgaccatgctgctgccg
cggctcgcggccgtcgccgaggtcgcgtggagcgcgcccgcgcggcgcgacttcgacgac
ttcgcggagcggctgcgcagccacgggcggcactgggaccgcatgggcctcgcgtggcac
ccgtcccggcagggtcgctgggacgggtga

DBGET integrated database retrieval system