KEGG   Cellulomonas flavigena: Cfla_0850Help
Entry
Cfla_0850         CDS       T01230                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00450  Selenocompound metabolism
cfl00970  Aminoacyl-tRNA biosynthesis
cfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cfla_0850
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cfla_0850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfl01007]
    Cfla_0850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfl03016]
    Cfla_0850
Enzymes [BR:cfl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Cfla_0850
Amino acid related enzymes [BR:cfl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cfla_0850
Transfer RNA biogenesis [BR:cfl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cfla_0850
 Prokaryotic type
   Other AARSs
    Cfla_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADG73760
UniProt: D5UK18
Position
925586..927373
Genome map
AA seq 595 aa AA seqDB search
MSRILSAVAWPYANGPRHIGHVAGFGIPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVQA
DKEGVSAQELADRYNRVIVEDLTQLGLSYDLFTRTTTRNHYAVVQEMFRTVHRNGYMVER
TTMGAVSPSTGRTLPDRYIEGTCPICGYDGARGDQCDNCGNQLDAIELKNPRSRINGETP
RFVESNHFFLDLPAFVDALGDWLRARDGWRPNVLKFSLNLLDDVRPRAMTRDIDWGIPVP
LEGWEDNPSKRLYVWFDAVIGYLSASIEWARRSGDPDAWRQWWNDPEALSYYFMGKDNIT
FHSQIWPAELLGYDGKGARGGEPGAFGSLNLPTEVVSSEFLNVEGKQFSTSRGVVILVRD
MLARYQPDALRYYISVAGPETQDVDFTWAEFKRRTNDELVAGWGNLVNRTASMVHKNFGE
IPTPGELQPVDVELNAQVAAAFGRVGELVGAHRQRQALQEAMRVVTEANRYVSETEPWKL
KTDRDRLATVLHTTTQAVSDLNTLLAPFLPHSAQAVHEALGGTGTFSPQPRIEEVADLDD
DSRHYPVITGDYTAVRGTWQPRAVVPGTRIDKPTPVFTKLDDAIVEEELERLRQS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcctgtcggccgtcgcgtggccctacgcgaacggtccccgccacatcggt
cacgtcgccggcttcggcatcccctcggacgtcttcagccggtacatgcgcatggcgggg
cacgacgtgctcatggtgtcgggcacggacgagcacggcacgccgatcctggtgcaggcc
gacaaggagggcgtcagcgcgcaggagctcgcggaccggtacaaccgcgtcatcgtcgag
gacctcacgcagctcggcctgtcgtacgacctgttcacgcgcaccacgacccgcaaccac
tacgcggtcgtgcaggagatgttccgcacggtgcacaggaacgggtacatggtcgagcgg
accacgatgggcgcggtcagcccgtcgaccggccgcacgctgccggaccgctacatcgag
ggcacctgccccatctgcgggtacgacggcgcgcgcggcgaccagtgcgacaactgcggc
aaccagctcgacgcgatcgagctgaagaacccccgcagcaggatcaacggcgagacgccg
aggttcgtcgagtcgaaccacttcttcctcgacctgccggcgttcgtcgacgcgctgggc
gactggctgcgcgcgcgcgacggctggcggcccaacgtcctgaagttctcgctcaacctg
ctcgacgacgtgcgcccgcgcgccatgacgcgcgacatcgactggggcatccccgtgccg
ctcgagggctgggaggacaacccgtccaagcgcctgtacgtgtggttcgacgcggtcatc
gggtacctgtcggcgtcgatcgagtgggcgcgccgcagcggtgaccccgacgcgtggcgg
cagtggtggaacgaccccgaggccctgtcgtactacttcatgggcaaggacaacatcacg
ttccactcgcagatctggccggcggagctgctcgggtacgacggcaagggcgcgcgcggc
ggcgagccgggtgcgttcgggtccctcaacctgccgaccgaggtcgtgtcgagcgagttc
ctcaacgtcgagggcaagcagttctcgacgtcgcgcggggtcgtcatcctggtgcgcgac
atgcttgcgcggtaccagcccgacgcgctgcgctactacatctcggtcgccggcccggag
acgcaggacgtcgacttcacgtgggcggagttcaagcgccgcaccaacgacgagctggtc
gcgggctggggcaacctggtcaaccggaccgcgagcatggtgcacaagaacttcggtgag
atcccgacgccgggcgagctgcagccggtcgacgtcgagctgaacgcgcaggtggccgcg
gccttcgggcgcgtcggcgagctcgtgggcgcacaccggcagcggcaggcgctccaggag
gccatgcgcgtggtcaccgaggccaaccggtacgtctcggagaccgagccgtggaagctg
aagacggaccgtgaccgcctggcgaccgtgctgcacacgacgacgcaggcggtcagcgac
ctcaacacgctgctcgcgccgttcctgccgcacagcgcgcaggccgtgcacgaggcgctc
ggcgggacgggcacgttctcgccgcagccgcggatcgaggaggtcgccgacctcgacgac
gacagccggcactacccggtcatcaccggcgactacacggccgtgcgcgggacgtggcag
ccgcgggcggtcgttccgggcacgcggatcgacaagccgacgccggtcttcaccaagctc
gacgacgcgatcgtcgaggaggagctcgagcggctccggcagtcctga

DBGET integrated database retrieval system