KEGG   Cellulomonas flavigena: Cfla_1016Help
Entry
Cfla_1016         CDS       T01230                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00020  Citrate cycle (TCA cycle)
cfl00190  Oxidative phosphorylation
cfl00650  Butanoate metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_1016
   00650 Butanoate metabolism
    Cfla_1016
  Energy metabolism
   00190 Oxidative phosphorylation
    Cfla_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Cyt_bd_oxida_II CybS
Motif
Other DBs
NCBI-ProteinID: ADG73922
UniProt: D5UKV4
Position
complement(1125613..1126071)
Genome map
AA seq 152 aa AA seqDB search
MSAIADPKAPRASRPGPSRRTTRGNFELYGWMFMRGSGVVLVVLIFGHLFVNLMVGEGIS
AIDFGFVAGKWASPFWQVWDLLMLWLAMLHGTNGVRTIINDYAEKDTTRLVLKLALYVAT
TLVIVLGTLVIFTFDPCPPNSPADLLPSFCTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatcgccgatcccaaggccccgcgcgcctcgcgcccgggcccgtcgcgccgc
accacgcgcggcaacttcgagctgtacggctggatgttcatgcgcgggtcgggcgtcgtc
ctggtcgtgctgatcttcggccacctgttcgtcaacctcatggtcggcgagggcatcagc
gcgatcgacttcggcttcgtcgcgggcaagtgggcgtcgccgttctggcaggtctgggac
ctgctgatgctgtggctcgcgatgctgcacggcaccaacggcgtgcggacgatcatcaac
gactacgccgagaaggacaccacgcgtctggtgctcaagctcgcgctgtacgtcgccacc
acgctcgtcatcgtgctcggcacgctcgtgatcttcacgttcgacccgtgcccgccgaac
agcccggccgacctgctgccgtccttctgcacggcctga

DBGET integrated database retrieval system