KEGG   Cellulomonas flavigena: Cfla_1908Help
Entry
Cfla_1908         CDS       T01230                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00020  Citrate cycle (TCA cycle)
cfl00620  Pyruvate metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_1908
   00620 Pyruvate metabolism
    Cfla_1908
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Cfla_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: ADG74804
UniProt: D5UEZ4
Position
2123834..2125321
Genome map
AA seq 495 aa AA seqDB search
MAARNQDTAADVDVLLVGGGIMSATLASLIGTLEPSWRIEVHERLDSPATESSNAWNNAG
TGHAALCELNYTPQRADGSVDVTKAVTINEQYELSRELWHHLAAAGRLPGAEDAVTTTPH
LTFVRGAEDVEFLRRRWEALRRHRLFADLEFTTDRAVIARWAPLLVTDRLDDEPVAATRA
TWGTDVDFGSLTRAMLADAVTRGATVHTSSEVTRLRRLRDGRWRVTVADRRWNGNPPRTL
TARFVFVGAGGGALHLLQRSRIKEIRGYAGFPISGQFLRTTNPGLVAQHRAKVYGKAAIG
APPMSVPHLDARVVDGDQALMFGPYAGWSMKFLKRGSWTDLLRSVRPGNLVPMIAVGLRN
MSLVTYLIREVTADDAARLRSLRSYMPSADPRDWELITAGQRVQVIKRGKGGGVLEFGTE
LVTSQDGSIAGLLGASPGASTAVATMLDLLERCFPERADAWRPQLQQLMPSMGGGAWDAA
LEQQLVDDGTLTGGH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcgcgaaaccaggacaccgcagccgacgtcgacgtgctcctcgtcggcggcggg
atcatgagcgcgaccctggcgtcgctcatcgggacgctcgagccgagctggcgcatcgag
gtgcacgagcgcctcgactccccggcgacggagagctccaacgcgtggaacaacgccggc
acgggccacgccgctctctgcgagctcaactacacgccgcagcgcgccgacggctccgtc
gacgtcaccaaggccgtgacgatcaacgagcagtacgagctctcgcgggagctctggcac
cacctcgccgccgccggccgcctgcccggggccgaggacgccgtcacgacgaccccgcac
ctcacgttcgtgcgcggggccgaggacgtcgagttcctgcgccggcgctgggaggcgctg
cgccggcaccggctcttcgcggacctcgagttcaccaccgaccgggccgtcatcgcccgc
tgggcgcccctgctggtcaccgatcgcctcgacgacgagcccgtcgccgcgacgcgcgcg
acctggggcaccgacgtcgacttcggctcgctcacacgcgccatgctcgccgacgccgtc
acgcgcggcgcgaccgtgcacaccagcagcgaggtcacccgcctgcggcggctgcgggac
ggccgctggcgcgtcaccgtcgccgaccgccgctggaacggcaacccgccgcgtacgctc
acggcccggttcgtgttcgtcggcgccgggggcggcgcgctgcacctgctgcagcgctcg
cggatcaaggagatccgcggctacgccggcttcccgatcagcggccagttcctgcggacc
accaaccccgggctcgtggcgcagcaccgcgccaaggtgtacggcaaggccgcgatcggt
gccccgccgatgtcggtgccgcacctcgacgcacgcgtcgtggacggcgaccaggcactg
atgttcggcccctacgcgggctggagcatgaagttcctcaagcggggctcgtggacggac
ctgctgcgctcggtgcgcccgggcaacctcgtgccgatgatcgccgtcggcctgcgcaac
atgagcctggtcacctacctgatccgtgaggtcacggcggacgacgccgcgcgcctgcgg
tcgctgcggtcgtacatgccgtcggcggacccgcgcgactgggagctcatcacggccggg
cagcgcgtgcaggtcatcaagcgcggcaagggcggcggcgtgctcgagttcggcaccgag
ctcgtgacctcgcaggacggctcgatcgccgggctgctcggcgcctcgccgggcgcgtcg
accgcggtcgccacgatgctcgacctcctggagcggtgcttccccgagcgggcggacgcg
tggcggccccagctccagcagctcatgccgagcatgggcggcggtgcgtgggacgcagcg
ctcgagcagcagctcgtggacgacgggacgctcacgggcggacactga

DBGET integrated database retrieval system