KEGG   Cellulomonas flavigena: Cfla_1936Help
Entry
Cfla_1936         CDS       T01230                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00030  Pentose phosphate pathway
cfl00480  Glutathione metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cfl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cfla_1936
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cfla_1936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfl04147]
    Cfla_1936
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Cfla_1936
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Cfla_1936
Exosome [BR:cfl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cfla_1936
  Exosomal proteins of colorectal cancer cells
   Cfla_1936
  Exosomal proteins of bladder cancer cells
   Cfla_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADG74831
UniProt: D5UF21
Position
2152954..2154495
Genome map
AA seq 513 aa AA seqDB search
MTPAKVGPQQNPLRDTRDRRLPRIAGPCGLVIFGVTGDLARKKLMPAVYDLTNRGLLPPG
FALTGFARRDWETQDFEQVVHDSVKQYARTPFREATWRQLAEGIRFVQGTFDDDAAFDEL
SRTVEELDVTRGTGGNHAFYLSVPPSSFPVVCEQLARSGLSQPKEGTWRRVVIEKPFGHD
LESARELNDIVSQVFRPDDIFRIDHYLGKETVQNILALRFANQLFEPIWNGNYVDHVQIT
MAEDIGIGGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPVSFDAASLRAEKTKVLSAVR
LPRDLGRHTARGQYTAGWQGGEKVVGYADEEGFNPDSTTETYAAVRVDIDTRRWAGVPFY
LRTGKRLGRRVTEIAVVFKKAPHLPFEATSAEELGKNALVIRVQPDEGVTLRFGAKVPGT
QMEVRDVTMDFGYGHAFTESSPEAYERLILDVLLGDPPLFPQHEEVELSWKILDPVTAYW
ASKGKPDEYRAGTWGPASADEMMARDGRAWRLP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgactcccgcgaaggtcggcccgcagcagaacccgctccgcgacacccgtgaccgccgg
ctgccgcgcatcgccggaccgtgcggcctggtgatcttcggtgtcacgggggacctcgcg
cgcaagaagctcatgccggcggtgtacgacctcaccaaccgcggtctgctgcctccgggc
ttcgcgctgacgggcttcgctcgccgcgactgggagacgcaggacttcgagcaggtcgtg
cacgactcggtcaagcagtacgcgcgcacgccgttccgcgaggcgacgtggcgccagctc
gccgagggcatccgcttcgtgcagggcacgttcgacgacgacgcggctttcgacgagctg
agccggaccgtcgaggagctcgacgtgacgcgcgggaccggcggcaaccacgcgttctac
ctctcggtgccgccgagctccttccctgtcgtctgcgagcagctcgcccgctcggggctc
tcgcagcccaaggagggcacctggcggcgtgtcgtcatcgagaagccgttcgggcacgac
ctggagtcggcacgcgagctcaacgacatcgtgtcgcaggtattccggcccgacgacatc
ttccgcatcgaccactacctgggcaaggagacggtccagaacatcctggcgctgcgcttc
gcgaaccagctgttcgagccgatctggaacggcaactacgtcgaccacgtgcagatcacg
atggccgaggacatcggcatcggcggccgcgccgggtactacgacggcatcggtgccgcg
cgcgacgtcatccagaaccacctcctgcagctcctggccctcaccgccatggaggagccc
gtctcgttcgacgccgcctcgctgcgcgccgagaagaccaaggtgctctcggcggtgcgc
ctgccccgcgacctcggtcgccacaccgcacgcgggcagtacacggccgggtggcagggc
ggcgagaaggtcgtcgggtacgccgacgaggaggggttcaaccccgactccacgaccgag
acgtacgccgcggtccgcgtcgacatcgacacgcgccgctgggccggcgtgccgttctac
ctgcgcacgggcaagcgcctgggccggcgtgtcaccgagatcgccgtggtcttcaagaag
gccccgcacctgccgttcgaggccacctcggcggaggagctcggcaagaacgccctggtc
atccgcgtgcagcccgacgagggcgtcacgctgcggttcggtgcgaaggtgccgggcacc
cagatggaggtccgcgacgtcacgatggacttcggctacgggcacgcgttcaccgagtcc
tcgcccgaggcgtacgagcgcctcatcctcgacgtcctgctcggcgaccccccgctgttc
ccccagcacgaggaggtcgagctctcctggaagatcctcgaccccgtcaccgcctactgg
gcctcgaagggcaagcccgacgagtaccgcgcgggcacctggggccccgcgtcggccgac
gagatgatggcccgcgacgggcgtgcctggaggctgccgtga

DBGET integrated database retrieval system