KEGG   Cellulomonas flavigena: Cfla_1984Help
Entry
Cfla_1984         CDS       T01230                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00260  Glycine, serine and threonine metabolism
cfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01130  Biosynthesis of antibiotics
cfl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_1984
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cfla_1984
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cfla_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB NanE Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ADG74879
UniProt: D5UF82
Position
complement(2212291..2213127)
Genome map
AA seq 278 aa AA seqDB search
MSVTDVRSATGERLDELAAGPAPRAALVGYLPVGFPTVPGSARAVRTMVDAGVDVVELGI
PYTDPVMDGPVIQAAANRALAQGTRVADTLRVAEQVAGAGAPVLVMTYWNIVLRYGVDAF
ARDLAAAGGAGLITPDLIPDEGAEWLAASDAHGLDRVFLVAPSSTPERLASTVAASRGFV
YAASTMGVTGERTTVGDRAEQLVAATRAAGAARVCVGLGVSRPEQAAEVAGYADGVIVGS
ALVRALLEAPDEASGLTALEGVVRGLADGVRGAVRAPR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgacggacgtgcggtcggcgacgggggagcggctcgatgagctcgccgccggg
cccgccccccgggcggcgctcgtcggctacctgcccgtcggcttcccgacggtgccgggg
tcggcacgcgcggtgcgcaccatggtcgacgccggcgtcgacgtcgtcgagctcggcatc
ccgtacaccgatcccgtcatggacgggccggtcatccaggccgcggcgaaccgcgcgctc
gcacagggcacgcgcgtggccgacacgctgcgcgtcgcggagcaggtcgccggcgccggt
gcgcccgtgctggtgatgacctactggaacatcgtcctgcggtacggcgtcgacgcgttc
gcccgggatctcgcggccgcgggcggcgcaggcctcatcacccccgacctcatccccgac
gagggtgcggagtggctcgccgccagcgacgcgcacggcctggaccgggtgttcctcgtc
gccccgagctccacgccggagcggctcgcctccacggtggcggccagccgcgggttcgtc
tacgcggcctcgacgatgggcgtcacgggtgagcgcacgacggtgggggaccgcgcggag
cagctcgtggccgcgacccgggctgccggggcggcacgcgtgtgcgtcggcctcggcgtc
tcgcggcccgagcaggctgccgaggtcgcgggctacgccgacggcgtgatcgtgggctcg
gcgctcgtgcgcgccctgctggaggcaccggacgaggcgtcgggcctcaccgcgctcgag
ggggtcgtccgcgggctcgcggacggggtgcggggggcggtccgggcgccgcgatga

DBGET integrated database retrieval system