KEGG   Cellulomonas flavigena: Cfla_2123Help
Entry
Cfla_2123         CDS       T01230                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00010  Glycolysis / Gluconeogenesis
cfl00520  Amino sugar and nucleotide sugar metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_2123
   00520 Amino sugar and nucleotide sugar metabolism
    Cfla_2123
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cfla_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADG75018
UniProt: D5UFZ5
Position
2369247..2370029
Genome map
AA seq 260 aa AA seqDB search
MSKDARHRSTEAGTAFGVDIGGSGIKGAPVDLATGEFAGERVRIPTPQPATPDAVARTVA
QVVDSFDLPRELPIGVTFPAVIRHGVAQSAANVDDAWIGTDVAATIGGATGRRVVAVNDA
DAAGYAEVAYGAAKDVQGVVLVVTLGTGIGSALVVDGQLVPNTELGHLEIDGHDAESRAS
DAARDREDLSFEQWAQRLQRYFSVVEDLFWPDLIVVGGGVSKKHAQFLPLLDLRTPIVPA
GLRNAAGIVGAARLAAGGSR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggacgcgaggcacaggagcacggaggccggcaccgcgttcggcgtcgacatc
ggcgggtccggcatcaagggcgctccggtcgacctggcgaccggggagttcgcgggcgag
cgcgtgcggatccccacgccgcagccggccacgccggacgcggtggcgcgcacggtcgcg
caggtcgtcgactcgttcgacctgccgcgcgagctgccgatcggggtgacgttccccgcg
gtgatccggcacggcgtcgcacagtcggcagcgaacgtcgacgacgcgtggatcggcacg
gacgtcgccgcgacgatcggcggggccacgggccggcgcgtggtggcggtcaacgacgcc
gacgccgcggggtacgccgaggtcgcgtacggcgccgcgaaggacgtgcagggcgtggtg
ctcgtcgtgaccctgggcacgggcatcgggtcggcgctcgtcgtcgacgggcagctcgtg
cccaacaccgagctgggccacctggagatcgacgggcacgacgcggagtcccgcgcgtcc
gacgcggcccgcgaccgcgaggacctgtcgttcgagcagtgggcgcagcgcctgcagcgg
tacttctcggtcgtcgaggacctgttctggcccgacctgatcgtcgtcggcgggggcgtg
agcaagaagcacgcgcagttcctgccgctgctcgacctgcgcacgcccatcgtgcccgca
gggctgcgcaacgccgccgggatcgtcggcgccgcgcgcctcgcggccggcggcagccgc
tga

DBGET integrated database retrieval system