KEGG   Cellulomonas flavigena: Cfla_2654Help
Entry
Cfla_2654         CDS       T01230                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cfl  Cellulomonas flavigena
Pathway
cfl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cfl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Cfla_2654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cfl03011]
    Cfla_2654
Ribosome [BR:cfl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Cfla_2654
  Bacteria
    Cfla_2654
  Archaea
    Cfla_2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADG75541
UniProt: D5UIX5
Position
complement(2954422..2954790)
Genome map
AA seq 122 aa AA seqDB search
MEAKAKARFVRVTPQKARRVVDLIRGKQAAEAVAVLKFAPQAAAEPVLKTVQSAVANAVE
GAKRNSERLDEADLFISEVFVDEGPTLKRFRPRAQGRASQILKRTSHITVVVAERETKGR
AR
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggcgaaggcgcggttcgtccgcgtcacgccccagaaggcccgccgcgtc
gtggacctcatccgtggcaagcaggcggcggaggccgtggcggtgctgaagttcgcgccc
caggccgcggcggagcccgtcctcaagacggtgcagtccgcggtcgcgaacgcggtcgag
ggagccaagcgcaacagcgagcgcctcgacgaggcagacctcttcatctcggaggtcttc
gtcgacgagggcccgacgctcaagcggttccggccgcgggcgcagggtcgcgcgagccag
atcctcaagcgcacgagccacatcaccgtggtcgtcgctgagcgagagacgaagggacgg
gcccgatag

DBGET integrated database retrieval system