KEGG   Clostridium formicaceticum: BJL90_03920Help
Entry
BJL90_03920       CDS       T05005                                 

Definition
(GenBank) FAD-dependent thymidylate synthase
  KO
K03465  thymidylate synthase (FAD) [EC:2.1.1.148]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00240  Pyrimidine metabolism
cfm00670  One carbon pool by folate
cfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BJL90_03920
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BJL90_03920
Enzymes [BR:cfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.148  thymidylate synthase (FAD)
     BJL90_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thy1 ChaB SPX RelB_transactiv DUF4145
Motif
Other DBs
NCBI-ProteinID: AOY75124
UniProt: A0A1D9FIW0
Position
complement(812398..813252)
Genome map
AA seq 284 aa AA seqDB search
MKTTLRLKLLAYTPNPDAVVAKGGKLCYYPGGIEELEEGLTEEKISKFVTMLAEMEHESP
LEHAVFTFGIEGVSRSLTHQLVRHRLASYSQKSQRYVSEGSFEYVMPKDISDNEEAKKVF
VKAMENAQEAYDKITEELLAEKIKTFYKGKKQTIDEEKAGLLQEIKIMGNQEVIQHCKKH
FKRDYSRLEKLSIENARAVLPNACETKIIVTMNARILLHFFKKRCCSRAQEEIRDLATEM
LKLVKTVAPNIFKYAGPACLHDVCPEGDMTCGRIKEVREQFGQM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacgctaagattaaagttattggcatatacaccaaatcctgatgcagttgta
gcaaaaggaggtaagctttgctattatccaggaggtattgaggaattagaagaaggtttg
acggaggaaaaaataagtaaatttgtaacgatgttggcggaaatggaacatgagtctccc
ctagagcatgctgtatttaccttcggcatagaaggtgtttcaagaagtttgacgcatcaa
ctggttcgacatagattagccagttatagtcaaaagtctcaaagatatgtttcggaaggt
agttttgagtatgtgatgcctaaagatataagcgacaacgaagaagcaaagaaggtcttt
gttaaggcgatggaaaatgcccaagaggcctatgacaaaattacagaagaactattggca
gaaaaaatcaagacattttataaaggaaaaaaacaaacaatagatgaggagaaggcaggt
ttattacaggagataaaaatcatggggaatcaagaagtgattcaacattgtaaaaaacac
ttcaaaagagattatagtagactagaaaaactttctatagagaatgcccgagcagtttta
cccaatgcttgtgagacgaaaatcattgttactatgaacgccagaatattattacacttt
ttcaagaaacgctgctgtagccgggcgcaggaagaaataagagacttagctaccgaaatg
ttgaaattagtaaagacagtagcgcctaatatctttaagtatgctggacctgcttgtctc
catgatgtttgtccagaaggggatatgacttgtgggagaatcaaagaggttagagagcaa
tttggtcagatgtga

DBGET integrated database retrieval system