KEGG   Clostridium formicaceticum: BJL90_05985Help
Entry
BJL90_05985       CDS       T05005                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00450  Selenocompound metabolism
cfm00970  Aminoacyl-tRNA biosynthesis
cfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJL90_05985
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJL90_05985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cfm01007]
    BJL90_05985
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cfm03016]
    BJL90_05985
Enzymes [BR:cfm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJL90_05985
Amino acid related enzymes [BR:cfm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJL90_05985
Transfer RNA biogenesis [BR:cfm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJL90_05985
 Prokaryotic type
   Other AARSs
    BJL90_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d zinc-ribbons_6 CorC_HlyC
Motif
Other DBs
NCBI-ProteinID: AOY75485
UniProt: A0A1D9FJL8
Position
1274659..1276620
Genome map
AA seq 653 aa AA seqDB search
MSKGTYYLTTPIYYPSAKLHIGHTYTTVASDVLARFKRFTGYDVQFLTGTDEHGEKIQKA
AKEKGMAPKAYVDEIVRDIKDIWKKMDISYDIFIRTTDEHHVKSVQKIFQKLYDQGDIYK
GEYEGWYCTPCESFWTKTQLKEEKLCPDCGRPAELAKEEAYFFKLSKYQDRLIQYFEEHP
EICLPESRKNEMLNNFLKAGLEDLAVSRTSFDWGIPVPFDPKHVIYVWIDALSNYITALG
YGSDNQEKYEKYWPANVHIMAKEIIRFHTIIWPAMLMALGEPLPKMVYGHGWIMFGDDKM
SKSKGNIVYPEPLIERYGLDALKYFLLREFTFGYDGTYTNRSFVNRLNADLSNDLGNLVS
RSITMIEKYNGGMIPEGKVTGEFDEDLKRVATTAAEKVEKAIDKLQFHEGLEEIWKVIRR
VNKYIDETTPWILAKEASNKENLGTVLYNLADSLRIISILIKPFMEATTTKIWAQLGIDK
EQCTSWEDAAVFGKIPVGTQVKRGEILFPRLEIEKEVEELEKINEAYFKKINGIPETGEV
VEIEAKEEITIDDFDKLELRVAKVLKAEKHPKADKLLVLQLQVGNETRQVVSGIAEHYKP
EDMVGKSVILVANLKPVKLRGVESRGMILAASNDEKLVLGTIDADIPAGTLMS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaggaacatattatttgactacacctatttattaccccagtgcaaaactacat
ataggacatacctacacaactgtagcatccgacgttttagctagatttaagcgctttacc
ggctacgacgtgcagtttttgacgggaaccgatgagcatggtgaaaaaattcaaaaagct
gctaaagaaaaaggtatggcgccaaaggcttatgtagatgaaatcgtaagggatattaaa
gatatatggaaaaaaatggatatatcttatgatatttttattcgaactacggatgaacat
catgtaaaaagtgttcagaaaattttccaaaaactctacgatcaaggagatatctataaa
ggtgaatacgaaggatggtactgtactccctgtgaatctttttggacaaaaactcagtta
aaagaagagaaactttgtcctgattgcggcagacctgctgagttagctaaggaagaggcg
tattttttcaaactatcgaagtatcaagaccggttaattcaatatttcgaagaacatcca
gaaatttgccttcctgaatcaagaaagaatgaaatgttaaataactttctaaaagcaggc
ttggaagacctagctgtatctagaactagctttgattgggggataccagtgccctttgac
ccaaaacacgtgatctatgtatggattgatgcattatccaactatattactgctttaggc
tatggttcagataatcaagaaaaatatgaaaagtattggcctgcaaatgttcatattatg
gcaaaagaaatcatcagattccacaccattatttggccagcaatgttaatggctttaggc
gagccgctgccgaaaatggtttatggacatggatggattatgtttggcgatgacaaaatg
tcaaagtctaagggtaatattgtttatcctgaacctcttattgaaagatacggacttgac
gcactgaagtatttcttactaagggaatttacctttggctatgacggaacctacactaat
agaagttttgttaatcgacttaatgctgatctatccaatgacttaggaaatctagtaagt
agaagtattactatgattgaaaaatataatgggggtatgataccagaaggaaaagtaaca
ggggagtttgacgaggacttaaaacgcgtcgcaactacagctgctgaaaaagtagaaaaa
gctatagacaaacttcaattccatgaaggtttagaagaaatttggaaggtaatccgcaga
gtgaataaatatattgatgaaacgacgccttggattctagcaaaagaggcgtcaaataag
gaaaatttaggtaccgtactgtataacttagccgatagccttcgtatcatttctatacta
ataaagccttttatggaagcaaccactacaaaaatatgggcacaattaggcatagacaaa
gaacagtgtacaagctgggaggatgctgctgtatttggcaagattcctgttggaactcaa
gtgaaaagaggagaaattcttttccctagactagagatagaaaaagaagtggaggaactg
gagaaaataaacgaagcctactttaaaaagattaatggtataccagaaacaggagaagta
gtagagatagaagcaaaagaggaaattactatcgatgattttgataagctggaattaaga
gtagccaaagttttaaaagcggagaagcatcctaaagctgataaattactagtactacag
ctacaggtaggcaatgaaaccagacaagtagtttctggtattgcagaacattataaacca
gaggatatggtgggcaaatcagtgattctggtggcaaatctaaagcctgtaaaactaaga
ggcgtagaatcaagaggaatgattttagccgcttctaacgacgaaaaacttgtactggga
acaattgatgctgatataccagcagggacactgatgagctaa

DBGET integrated database retrieval system