KEGG   Clostridium formicaceticum: BJL90_08070Help
Entry
BJL90_08070       CDS       T05005                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJL90_08070
Enzymes [BR:cfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BJL90_08070
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BJL90_08070
    1.1.1.-  
     BJL90_08070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 NAD_binding_3 AlaDh_PNT_C NAD_binding_7 Shikimate_DH 2-Hacid_dh_C F420_oxidored Sacchrp_dh_NADP DapB_N AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AOY75853
UniProt: A0A1D9FKH5
Position
1733275..1734330
Genome map
AA seq 351 aa AA seqDB search
MKAAVWYGKKDVRIMEVPEPPAPGKGEVKIKVQWCGICGSDLHEYLAGPIFIPTEPHPLT
GDKAPIILGHEFSGEIVEIGPEVEGFKVGDRVAPDACQVCHTCNPCKIGKYNVCEKLAFT
GLMTNGAFAEYVVVPDYTLYKIPDDMTYETAALLEPISVGIHAVRQAPILQGENVVIFGA
GTIGLATLQAVRAAGASKIYVVEVAKARKAYAKQMGATEVFDPNEVDIKEKIKEVTKGVG
TDVVFECIGSEKVTPLAVEVARTGGKIVVVGVYEKETSLNFNNIVFKDKHIVGSLAYAGD
FEIAIDLMNDGRIQADALITGKIKIDDLVEKGFDELVHRKEENIKILVTPW
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagtatggtatggaaaaaaagatgttagaatcatggaggtaccagaacct
ccagcaccaggtaagggagaagtaaaaataaaagttcaatggtgcggtatatgtggctca
gatttacatgagtatttagcaggtcctatttttattccaacagaaccacatccattaaca
ggcgataaggcccctatcattctcgggcatgaattttcaggagaaattgttgaaataggt
ccggaagttgaaggttttaaagtaggggatagggttgcacctgatgcatgtcaagtttgt
catacctgtaatccctgcaaaattggaaagtataatgtctgtgaaaaactagcttttact
ggcttgatgacaaatggcgcttttgcagagtacgttgttgttcctgattataccctctat
aaaattccagacgatatgacttatgaaacagcagccctgcttgaaccgatttctgtaggg
attcatgcggtacggcaggcaccaattcttcagggggaaaacgttgtaatatttggggca
gggacaattggcttagccacacttcaagcagttcgtgctgcaggggccagcaaaatatat
gtggtggaagtagctaaggctagaaaagcctatgccaagcaaatgggagccactgaagtc
tttgatccaaacgaagtggatattaaggaaaaaattaaagaagtcaccaagggtgtagga
acagatgtggtttttgaatgcattggcagtgaaaaggtaacccctctagctgtggaagta
gctaggacaggtggaaaaattgtagtagtaggtgtttatgaaaaagaaaccagccttaat
ttcaacaatattgtatttaaagataagcatattgttggttcattggcttatgctggagat
tttgaaattgcaattgatctaatgaatgatggacgtattcaggcggatgccttaattacc
ggaaaaatcaaaatagatgatttagtagaaaagggattcgatgaattagttcatcgtaag
gaggaaaatattaaaattttagtcacgccttggtag

DBGET integrated database retrieval system