KEGG   Clostridium formicaceticum: BJL90_11085Help
Entry
BJL90_11085       CDS       T05005                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00670  One carbon pool by folate
cfm01100  Metabolic pathways
cfm01120  Microbial metabolism in diverse environments
cfm01200  Carbon metabolism
Module
cfm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BJL90_11085
Enzymes [BR:cfm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BJL90_11085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: AOY76402
UniProt: A0A1D9FM79
Position
2501733..2503409
Genome map
AA seq 558 aa AA seqDB search
MSFKSDIEIAQEATPQDIREIAAKLNLTEDDIELYGKYKAKVDYNLLKKDNGGKKAKLIL
TTAINPTPAGEGKTTTTIGVSDALSRLGKKTIVALREPSLGPVFGVKGGAAGGGYAQVIP
MEDINLHFTGDFHAIGAANNLLAAMLDNHINHGNQLGIDSRKITWRRAVDMNDRQLRNMV
NGLGGKGNGIPREDGFDITVASEVMAAFCLASDIVDLKARLARIIVAYTRDDKPVTAGEL
NAHGAMAALLKDALKPNLVQTLEGTPAFVHGGPFANIAHGCNSVIATKMAMHFADYVVTE
AGFGADLGAEKFLDIKCRMADLKPDAVIIVATVRALKYNGGVAKQDLNQENLEALEKGLP
NLLKHVENITKVFKLPAVVAINQFPLDTEAELNLVKTKCKELGVNVALSAVWAKGGEGGE
ELANEVLRLTEQPSTLEYTYDLEMPIVDKIKAIAQKIYGADNADFTPAALKEIERLTKLG
FDKLPICMAKTQYSLTDNQNLLGRPTGFNITVRQVKVSAGAGFLVALTGEIMTMPGLPKV
PSAEKIDVDESGVITGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaaagtgatattgaaattgcacaagaggctacaccacaagacatcagagag
atagctgcaaaattaaacctaacagaggatgacatcgagctttatggtaagtacaaagct
aaggtagactacaatctacttaaaaaagacaatggcggtaagaaagcaaaattaatctta
actactgctattaacccaacacctgcaggtgaaggtaaaacaactactacaataggtgta
tctgatgccttaagtagacttggcaagaaaactatcgttgctttaagagaaccatctctt
ggaccagtatttggtgttaaaggtggagcagctggtggtggatatgctcaagtaatacca
atggaagatatcaacctacactttacaggtgacttccatgctataggtgcagcaaacaac
ttattagcagctatgcttgataaccacatcaatcatggtaaccaattaggaatcgacagc
agaaagattacatggcgtagagctgtggacatgaatgatagacaacttagaaatatggta
aatggattaggtggcaaaggtaatggtattccaagagaagatggttttgacattactgtt
gcttctgaagtaatggcagctttctgtctagctagtgatatcgtagacttaaaggcaaga
ttagcaagaattatcgtagcttacacaagagatgataagccagttacagcaggagaatta
aatgctcatggagctatggctgcattattgaaggatgctttaaagcctaacttagtacaa
acattagaaggaacaccagcttttgtacatggtggaccattcgcaaatatcgctcatggt
tgtaactcagtaattgctacaaaaatggcaatgcattttgcagattatgtagtaacagaa
gcaggatttggcgctgaccttggagcagaaaaattcttagatatcaagtgtagaatggct
gaccttaagcctgatgcagtaatcatcgttgcaactgtaagagcattaaaatacaacggt
ggcgtagcgaaacaagatttaaatcaagaaaatcttgaagcattagaaaagggtctacca
aacttattaaagcacgtagaaaatataacaaaagtattcaagttgccagcagtagtagct
attaatcaattcccacttgacacagaagcagagttaaaccttgtaaaaactaagtgtaaa
gaactaggcgtaaacgtagctttatcagcagtatgggcaaaaggtggagaaggtggagaa
gaattagctaacgaagtattaagattaactgagcaaccaagtacattagaatatacatat
gacttggagatgccaattgtagacaaaatcaaagcgattgctcaaaaaatctatggtgct
gacaatgcagactttacaccagcagctttaaaagaaatagaaagattgacaaagcttggc
tttgacaagttaccaatttgtatggcaaaaacccaatactctttaacagataaccaaaac
ttattgggaagacctacaggatttaatatcaccgtaagacaagttaaagtatctgcaggt
gctggattccttgtagctcttactggagaaatcatgacaatgccaggattaccaaaggtt
ccttcagctgaaaaaatcgatgttgatgaatcaggtgtaatcacaggattgttctaa

DBGET integrated database retrieval system