KEGG   Clostridium formicaceticum: BJL90_11120Help
Entry
BJL90_11120       CDS       T05005                                 

Definition
(GenBank) acetyl-CoA synthase subunit delta
  KO
K00194  acetyl-CoA decarbonylase/synthase, CODH/ACS complex subunit delta [EC:2.1.1.245]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00680  Methane metabolism
cfm01100  Metabolic pathways
cfm01120  Microbial metabolism in diverse environments
cfm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BJL90_11120
Enzymes [BR:cfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.245  5-methyltetrahydrosarcinapterin:corrinoid/iron-sulfur protein Co-methyltransferase
     BJL90_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdhD
Motif
Other DBs
NCBI-ProteinID: AOY78336
UniProt: A0A1D9FSJ8
Position
2508996..2509928
Genome map
AA seq 310 aa AA seqDB search
MSVQDYKGKINEVEVGKGDKAFKIGGEAAVAFYEFDGATGQAPKAGIEILDIYPEEWIPA
LQELYKDVANNPVEWAKFVEKELNPDFICLRFLGADPNGLDKSPEECAEVAKAVAEAITL
PLVIAGTGNHDKDSKLFEKVAAAVEGKNVLVLAATEENYKGVGAAAGLAYGHKVGAESSV
DINLAKQLNVLLGQLGVKAEDVVMNIGCSAVGYGFEYLISTVDRIRLAALGQNDKTLQMP
IITPVSFETWNVKEAVADEEDAPDWGSKEERGITMEVSTATSIITVGADAVILRHPKSLE
TVKKFVAALA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacaggattataagggaaagattaatgaagtagaagtaggaaaaggcgataag
gcattcaaaattgggggagaagctgcagttgcgttttatgaatttgacggtgcaactggt
caagcacctaaagcaggaattgagattttagacatttatccagaagaatggataccagca
ttacaagaattatataaagatgtagcaaacaaccctgttgaatgggcaaagtttgttgaa
aaagaactaaatcctgatttcatttgtttaagatttttaggtgctgatcctaatggatta
gataagtctcctgaggaatgtgctgaagttgcaaaagctgttgcagaagctattacttta
ccattagttattgctggaacaggcaaccatgataaggatagcaaattgtttgaaaaagta
gctgctgctgttgaaggcaagaacgttcttgttttagctgctacagaagaaaactataaa
ggtgttggagctgctgctggtttagcttacggtcataaagtaggtgcagaatcttcagta
gacattaaccttgcaaaacaattaaatgtacttttaggccaacttggcgttaaggctgaa
gacgtcgttatgaatattggatgttctgctgtaggatatggatttgaataccttatttca
acagtagatagaattagattagcagcattaggtcaaaacgataagactttacaaatgcct
attattacaccagtatcctttgaaacatggaatgttaaagaagcagttgcagatgaagaa
gatgctccagactgggggtctaaagaagaacgtggtattactatggaagtatcaacagct
acaagtattattactgtaggtgctgatgcagtaattcttcgtcatccaaaatcactagaa
acagtgaaaaagtttgtagcagcattagcataa

DBGET integrated database retrieval system