KEGG   Clostridium formicaceticum: BJL90_14535
Entry
BJL90_14535       CDS       T05005                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00472  D-Arginine and D-ornithine metabolism
cfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BJL90_14535
Enzymes [BR:cfm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BJL90_14535
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AOY76965
UniProt: A0A1D9FNW6
Position
3161361..3163571
AA seq 736 aa
MDLKPNEKLDIKTLLKDLDKYTPKRRGWTWRQKQENLQMGPFVYKDASMPLEQSTPLPSA
KYFGDIDPQPDSVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLIEGTP
QGIGGIPITRKQVRAQRKALDFIEEEVGRPINYHSYISGVAGPEIAVMFAEEGVNGAHQD
PQYNILYRNINMIRSFVDAAEAKQSMVWADIAQIDGAHNANATAREAWKVMPELMVQHAI
NSIYSVKVGMKKENICLSTVPPTAPPAPCMTLDLPYAVALRELFKEYKMRAQMNTKYMES
STREATVTHVLNLLISRLTRADIQSTITPDEGRNVPWHIYNIEACDTAKQALVGMDGLME
MIQLKDTGMLRDKARELKERAVLFMEEVLETGGYFNAVEAGFFVDSGYYPERNGDGITRK
IDSGIGVGTVYERDEDYLAPVTAHFGYNNVAQYDPSAVEEPSKLIDGCTFEKPEKIIFID
ELDETDNVNVRLEETKELRESTSIKPEVEWMGDGYVMLNLFLPLPKRAAQFAAIEIGKKM
GLEDVEVIHKEEMHPSEGTRIELKGRVGFTIDVKDLVIPPEPTIMSEDEIREAIEKQPMK
IVAGTVGEDEHSVGLREIIDIKHGGIEKYGIECHYLGTSVAIEKLVDAAIELNADAILAS
TIISHDDIHYKSMKKIHELCIEKGIRNDIMILCGGTQVTPELAVKQGVDAGFTRGTKGVH
VATFLVEKRREMQNED
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggatctaaagccaaatgagaaattagatattaaaaccttattaaaggatctagataaa
tatacgccaaaacgcagaggctggacatggaggcaaaaacaagagaacctacaaatggga
ccctttgtttataaagatgcctctatgccactggaacaaagcacgccactgccttcagca
aagtattttggtgatatcgacccccagccagattcggtgataacaacagaaattgcttct
gggaggttcgaagatgatattcggcgtatgaggatggcagcatggcacggagcagatcat
atcatggtgattcggacagccggtcaaagccactttgatggcttaatcgaaggaacgcct
caagggattggtggtattcccataactagaaaacaagtaagagcacaaagaaaagcttta
gattttattgaagaagaagtaggcagacccatcaactaccattcttacattagtggggtt
gccgggccggagatcgcagtgatgtttgcggaagaaggggtaaatggtgcccatcaagat
ccccagtacaacattttatatagaaatattaatatgattcgttcctttgtggatgctgct
gaagcaaaacaatcaatggtctgggcagatattgcacagattgatggagcacacaatgcc
aatgctactgctagagaagcctggaaggtaatgccagaactgatggtgcaacacgcaata
aattctatttattcggtaaaagtaggaatgaagaaggaaaatatatgcttatccactgtg
cctcctacagcaccaccagcaccttgtatgactttagatttgccttatgctgtagcacta
agggaattgtttaaagaatataaaatgagggcacaaatgaatacaaagtatatggaatct
tctaccagggaggccactgtaacccatgtactgaatttattaatttccagactaacaagg
gcagatattcaatctacaattacaccagatgaaggaagaaatgtgccgtggcatatttat
aatatagaggcatgtgatactgcaaagcaagcgctagtaggcatggatggattaatggag
atgatccagctgaaagatacaggcatgttgagggataaagctagagaactgaaggaaaga
gccgtattattcatggaggaggtactagaaacaggaggatactttaatgccgttgaagca
ggtttttttgtagattctggctattaccctgagagaaatggggacggtattactagaaag
atagattcaggtataggtgtagggacggtctatgaaagagatgaggactatttagctcca
gtaaccgcacatttcggctataacaatgtagcacaatatgatccttcagcagtagaggaa
ccatcaaagcttattgatggatgcacctttgaaaaaccagaaaaaattatctttatcgat
gagttggatgaaacggataatgtcaatgtgcgattagaagaaaccaaggaattaagggag
agcacaagcattaagccggaggtagaatggatgggagatggctatgtcatgttaaatctt
tttctaccgctgccaaagcgagctgcccaatttgcagcgattgagataggaaaaaagatg
ggcctagaagatgtagaggtgattcataaggaagagatgcacccttctgaaggtacaaga
atagagcttaagggaagagttggttttaccattgatgttaaggacttggtgattccacca
gagcctacaatcatgtctgaggacgaaataagagaggcaattgaaaagcagcctatgaaa
attgtcgcaggcacagtaggagaagatgagcactctgtagggctcagggaaatcatagat
attaaacatgggggcatcgaaaagtatggcattgaatgtcactatttaggtacttctgtg
gcgatagaaaagttagtagacgccgccatagaattaaatgctgatgctatattagcctct
accatcattagtcatgatgatattcactataaaagcatgaagaagattcacgaactttgt
atagaaaaaggaattcgcaatgatattatgattctttgcggagggactcaggtgacacct
gaattagctgtaaaacaaggggtagatgctggttttaccaggggaacaaagggtgtacat
gtggctaccttcctggttgaaaagagaagggaaatgcaaaatgaggattag

DBGET integrated database retrieval system