KEGG   Clostridium formicaceticum: BJL90_16160Help
Entry
BJL90_16160       CDS       T05005                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00620  Pyruvate metabolism
cfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJL90_16160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cfm02000]
    BJL90_16160
Enzymes [BR:cfm01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BJL90_16160
Transporters [BR:cfm02000]
 Other transporters
  Primary active transporters [TC:3]
   BJL90_16160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AOY77248
UniProt: A0A1D9FPF7
Position
complement(3474865..3476265)
Genome map
AA seq 466 aa AA seqDB search
MKPKLKITETVFRDAHQSLLATRMKTKDMLPIAEKMDEVGYHSLEMWGGATFDACLRFLN
EDPWERLRSIRKKVKKTKLQMLLRGQNLLGYKHYADDVVSEFVKKAIYNGIDIVRMFDAL
NDIRNLETTLKITKQEGGHAQCAISYTISPVHNLPYYVQKAKEMEGMGADSICIKDMSGI
LTPYAAYDLVKQLKQAVNIPIQLHTHYTSGIASMTYMKAIEAGIDVVDTAISPLALGTSQ
PPTEPIVAALKDTPYDTGIKLELLSEIADYFRPLRDKYLSEGLIDPKVLGVDANTLTYQV
PGGMLSNLISQLKQQNKLDKFEEVLAEVPKVREDLGYPPLVTPMSQMVGTQALFNVIIGE
RYKMVPKEIKDYVAGLYGQATTPIEDEVKQKIIGDKEVMTQRPADIIPPQLPSLKQEMKE
YLEQEEDVLSYALFPQVAMNFFKERWAEKYKIESTLYNEVEKNHPV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaagctaaaaattacggaaactgtctttagagatgcacatcaatcactttta
gctacaagaatgaaaacaaaggatatgttacctattgcagagaaaatggacgaagtgggt
tatcattctttagaaatgtggggaggagcaacttttgatgcatgcttaagatttctaaat
gaagatccttgggaaagacttagaagtataagaaaaaaagtaaaaaagacaaaactacaa
atgctgttgaggggacaaaatcttttaggctataaacattatgctgatgatgtggttagt
gaatttgttaaaaaagcaatttataatggtatagacattgtccgaatgtttgatgcactc
aatgacataagaaacctagaaactactttaaagataacgaaacaagaaggaggacatgct
cagtgtgcaatctcctataccattagtcctgttcataatctaccttattatgtgcaaaaa
gctaaagagatggaaggtatgggggcggactcgatttgtattaaggatatgtcgggtata
ttaacgccttatgcagcttatgacctagtgaaacaattaaaacaggcagtaaatattcct
atacaattacatacccattataccagtggtatcgcttctatgacttacatgaaggcaatt
gaagctggcatagatgttgtggacacagctatttctccattggctttgggaacttcacaa
ccacctacggaacctatagtagctgccttaaaggataccccttatgatactggcataaag
ctagaattactaagtgaaatagctgattattttagacccttaagggataaatacttaagt
gagggacttattgatcctaaggtattaggagtagatgctaataccttgacttaccaagtt
cctgggggaatgttatctaaccttatttctcaattaaagcaacaaaataagctggataaa
tttgaagaagttttagcagaagttccaaaagtaagggaggatttagggtatccaccttta
gttacccctatgagccagatggtaggaacccaggcgctgttcaatgtcatcataggtgag
cgctataaaatggtaccaaaagaaatcaaggattatgttgcaggactttatgggcaagcc
actactcctattgaggatgaagtaaaacaaaagattataggtgataaagaagtaatgaca
caaagaccagctgacattattccaccacaattaccttctttaaaacaagagatgaaggaa
tatctagaacaggaagaagatgttctttcctatgcattattcccacaggtggctatgaat
ttttttaaagaaagatgggctgaaaaatataaaatagagtctactttatataatgaagta
gaaaaaaaccatcctgtataa

DBGET integrated database retrieval system