KEGG   Clostridium formicaceticum: BJL90_20600Help
Entry
BJL90_20600       CDS       T05005                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00260  Glycine, serine and threonine metabolism
cfm00630  Glyoxylate and dicarboxylate metabolism
cfm00670  One carbon pool by folate
cfm01100  Metabolic pathways
cfm01110  Biosynthesis of secondary metabolites
cfm01130  Biosynthesis of antibiotics
cfm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJL90_20600
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BJL90_20600
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BJL90_20600
Enzymes [BR:cfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BJL90_20600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T SHMT GCV_T_C Aminotran_1_2 SoxG Rx_N
Motif
Other DBs
NCBI-ProteinID: AOY78053
UniProt: A0A1D9FRX9
Position
complement(4430177..4432825)
Genome map
AA seq 882 aa AA seqDB search
METLKRTVLFHEHLRLKANMVDFGGWEMPVNYPAGISEEHLYTRQKAGIFDISHMARFVI
TGKEAVKFLQHVLTSNVLALDLNQAQYTIIPNENGGALDDAYLYRFYEDQYLLVVNAANA
EKDWAHLTEVIKTFDAQITNQSDALAMIAIQGPDSKNILAELSGDAYLTEPVKNALNIVA
LDGKEVRIAKTGYTGEPIGFELFVKSEEAVAIWNLLIEKGAAPAGLGARDTLRMEAGYPL
YGHELGLDIDGKEIPIYSVPLAKFAVSFSEAKGDYIGKKALLKQFEVLQRIIKRDFSDIS
DLPRMIKPIALIGKGIARNGCKVYKDGVEVGYVTSGTMAPYFKTEGQGLDTIIKEEKGMR
SIGLALVNSDVLVNDEVEVEIRGKKAKAAITPYHLRGDAPPFARPILHGFEEIYKVDTPS
DYKTKALNLIEKSLENHMWRQEECINLIPSEQSHSSAVRLLSIMDPSFRYAEHKKIKSFY
DYDVFYYQGTKFIDEVEHLLVEELKKYFNCTEVETRVISGQMANTAVFSALMDYKNRVNR
KREASRLGYVLNNHIIKGGHLSAQPMGALHDYIAIDPVTEKSAVVNFPVLKDNNFKIDVE
ETKKVIDKFKPELIIFGKSMVLHKEPVKEIREFVDEQKINTTIMYDMAHVLGLAGDYFQN
PFAEGAEIVTGSTHKTFFGTQRGIIAGNYQKEDFKYEFWETIERRAFPGSVSNHHLGTML
GLLMAAYEMNYFKDAYQKNIIENAKHFAKALKEAGLEVVGDPAISYTETHQVMVNVGYGT
GPEVANRLEDNNIIVNYQATPEEEGFTASGALRIGVSEMVRFGFDKKEFEQLAEIIADVV
LRNKNVREDVKKLRSNFTSMKYCFTDEEIVEGLNKLAKGIHL
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggagactttaaaaagaacagtactttttcatgaacatttaagattaaaggcgaatatg
gtggactttggtggatgggaaatgcctgttaattatccagcaggtattagtgaggagcat
ctttatacacgacaaaaagcagggatttttgatatttcccacatggcaagatttgtgatc
actggaaaagaagcagtgaagtttttacagcatgttttaaccagcaatgttctagcgcta
gatttgaatcaggctcaatatactataatccctaatgaaaatggtggtgctctggacgat
gcttatctgtaccgcttttatgaggatcaatatttgttggtggtgaatgcggccaatgct
gagaaggattgggcacatttgacagaagttatcaaaacctttgatgcccaaatcaccaat
caatctgatgcacttgcaatgattgctatacaaggacctgattcaaaaaatattttggca
gagctttcaggagatgcttatttgacggaacctgttaaaaatgctcttaatattgttgcg
ttagatggtaaagaagtacgcattgctaaaacaggctatacaggagaacctataggtttc
gaactgtttgtcaaatctgaggaggctgttgccatttggaaccttttaatagaaaagggt
gcggcacctgctggtcttggagcaagggataccttaaggatggaagctggttatccactt
tatggtcatgaactaggtttagatattgatggtaaggaaattcctatttattctgtacca
ttagctaaatttgctgttagtttttctgaagcaaaaggagactacattggtaaaaaagca
ctactaaaacagtttgaggtcctacagagaataataaaaagagatttctcagatatttct
gatttgccaaggatgatcaagcctattgccttgatcggtaagggaattgcgagaaacggg
tgtaaagtatacaaagatggggtagaggtaggatatgtaaccagcggtacgatggcacct
tactttaagacagagggtcaggggttagacaccatcataaaagaggaaaaaggcatgaga
tccatcggccttgctcttgtcaacagcgatgttttagtaaacgatgaggtggaggttgag
atccgtggaaagaaagcaaaagcggcgataactccttatcatttgagaggggatgcacca
ccttttgcaaggcctattcttcacggttttgaagaaatatataaagttgatactccatca
gactataaaacaaaagcattgaacttgatcgagaaaagtttggaaaatcacatgtggcga
caggaggaatgtattaatttgataccttccgagcaatcccactccagtgctgtaagactg
ctatctattatggacccttccttcagatatgctgaacataagaaaataaaatctttctat
gactatgatgttttctattatcagggtacaaaatttatcgatgaagtagaacatctgctg
gtggaggaattgaaaaaatactttaattgtacagaagttgagacaagggtgatcagtggt
caaatggccaatacagcggtttttagtgctttaatggattacaaaaatagagtgaatcga
aagagggaggcaagccgattaggttatgttttaaacaaccatattatcaaaggtggccat
ctaagtgcacagcctatgggtgctttgcatgactatattgccattgaccctgttactgaa
aaatctgctgtagtgaatttcccggtattaaaggataataattttaagattgatgttgaa
gaaacaaagaaagttattgataaatttaagccggagctaatcatctttggcaaaagcatg
gtgttgcataaagagccagtaaaggaaattagagaatttgttgatgaacaaaaaattaat
acaacgattatgtacgatatggctcatgttcttggattagcgggggactacttccagaat
ccctttgctgagggagctgaaattgtcaccggttctacccataagacgttttttggtacc
caaagaggaattattgctggaaattatcaaaaagaagactttaaatacgagttttgggaa
accattgaaagaagagctttccctggaagtgtcagcaatcatcatttgggaaccatgctg
ggacttttgatggcggcttacgagatgaattatttcaaggatgcgtatcaaaaaaatatt
attgaaaatgcaaaacattttgcaaaagccttgaaggaagccggtttagaggtagtagga
gaccctgcgatatcttatactgagacccatcaggtgatggtcaatgtaggttacggtaca
ggccctgaggtagccaacagattagaagacaacaatattattgtaaactatcaggcaacg
ccagaggaagaaggctttactgcatcaggagccttacgtattggagtttctgagatggtg
agatttggtttcgataagaaggaatttgaacagttagcggaaattatagctgatgttgtt
ttaagaaataaaaatgttagggaagatgtaaaaaaactaagaagtaatttcaccagcatg
aagtattgctttacagatgaggagatcgttgagggcttgaataaactagctaaaggtatt
catctgtaa

DBGET integrated database retrieval system