KEGG   Clostridium formicaceticum: BJL90_20650Help
Entry
BJL90_20650       CDS       T05005                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cfm  Clostridium formicaceticum
Pathway
cfm00071  Fatty acid degradation
cfm00280  Valine, leucine and isoleucine degradation
cfm00310  Lysine degradation
cfm00362  Benzoate degradation
cfm00380  Tryptophan metabolism
cfm00620  Pyruvate metabolism
cfm00630  Glyoxylate and dicarboxylate metabolism
cfm00640  Propanoate metabolism
cfm00650  Butanoate metabolism
cfm00900  Terpenoid backbone biosynthesis
cfm01100  Metabolic pathways
cfm01110  Biosynthesis of secondary metabolites
cfm01120  Microbial metabolism in diverse environments
cfm01130  Biosynthesis of antibiotics
cfm01200  Carbon metabolism
cfm01212  Fatty acid metabolism
cfm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cfm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJL90_20650
   00630 Glyoxylate and dicarboxylate metabolism
    BJL90_20650
   00640 Propanoate metabolism
    BJL90_20650
   00650 Butanoate metabolism
    BJL90_20650
  Lipid metabolism
   00071 Fatty acid degradation
    BJL90_20650
   00072 Synthesis and degradation of ketone bodies
    BJL90_20650
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJL90_20650
   00310 Lysine degradation
    BJL90_20650
   00380 Tryptophan metabolism
    BJL90_20650
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJL90_20650
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJL90_20650
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJL90_20650
Enzymes [BR:cfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJL90_20650
Exosome [BR:cfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJL90_20650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOY78489
UniProt: A0A1D9FSZ5
Position
complement(4442078..4443256)
Genome map
AA seq 392 aa AA seqDB search
MKQVVIASAVRTAVGSFGGTLQNIPVAELGAIAIKAALERANIKGQDVDEVYMGCILQAG
AGQGVARQASVKAGIPVEVPATTINMLCGSGLRTVSLAVQTIIAGDNDIVVVGGTENMSQ
APYLLPKARWGHKMGEGTLVDSMVYDALTDAFNGYHMGITAENLADQYGISREEQDAFAA
ASQNKAEKAIAEGRFKDEIVPVEIPQKKGEPIVFDTDEHPKAGVTADKLSKLRPAFKKDG
TVTAGNASGINDGAAALVVMSKEKAEELGIQPLATIVSYANAGVDPSIMGIGPVPATERA
LKKANLTIEDMDLIEANEAFAAQALAVGKELKWNKEKVNVNGGAIALGHPVGASGARILV
TLLHEMMKRDAEHGLATLCIGGGMGTAVIIKR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagtagttatcgcaagtgctgtgagaacagctgtaggaagctttggaggaaca
ttgcaaaatataccggtagctgagctaggagccatagccattaaagctgcattagaaaga
gccaatataaaaggacaggatgttgatgaggtttatatgggctgtattcttcaagcgggg
gcaggccaaggggttgcccgtcaagcttctgttaaggcggggataccagtagaagttcca
gcaacaaccattaacatgctgtgtggatctgggcttagaactgtatctcttgcagttcaa
accatcatagcgggagataatgacattgttgtggtgggtggaacagagaatatgagtcaa
gcaccttatctattacctaaggctagatggggccataaaatgggtgagggaaccctagtg
gattctatggtttatgatgccttaaccgatgccttcaatggatatcatatgggtattaca
gcagaaaatttagcggatcaatatggtatctcaagagaagaacaagatgcatttgcggca
gccagtcaaaataaagcagaaaaagctattgcagaaggtagatttaaggatgaaattgtc
cctgtagaaatacctcaaaagaagggggagcctattgtatttgatacagatgaacatcca
aaagctggagtaactgcagataagctgagtaagctaagaccagcctttaagaaagatgga
accgtgacggcaggcaatgcatctggaatcaatgatggtgctgctgcgttggttgtaatg
tctaaggaaaaagcagaggagctaggcattcaacctttagcaaccattgtatcctatgct
aatgccggggtggacccttccatcatgggtatagggccagtgccagccacagaaagagca
ttaaaaaaggcgaatcttaccatagaagatatggatttaatcgaagccaacgaagctttt
gcagcacaagccttagctgttggcaaagagctgaaatggaataaggaaaaagtaaatgta
aatggcggtgctatagcactaggtcatcccgttggagccagtggggcaagaatacttgta
acactcttacatgagatgatgaaacgagatgctgagcatggcttagctacattatgtatc
ggtggaggaatgggcacagcggttattataaagagataa

DBGET integrated database retrieval system