KEGG   Clostridium formicaceticum: BJL90_20695Help
Entry
BJL90_20695       CDS       T05005                                 

Definition
(GenBank) hypothetical protein
Organism
cfm  Clostridium formicaceticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YitT_membrane TMEM70 SurA_N_3 COX16
Motif
Other DBs
NCBI-ProteinID: AOY78068
UniProt: A0A1D9FRQ7
Position
4451479..4452168
Genome map
AA seq 229 aa AA seqDB search
MKQFYARLLRLICGLFLYALGIVVTMNAHMGYAPWDVFHVGFAKTIGISIGTVSIITGVI
IGIITVLLGEKLGLGTILNMVLIGVFIDMLLGFHIIPVASNFMFGIIMLIVGLFIIALAS
YFYIESAFGAGPRDSLMFALTRKTGLPVGVCRGTIELLAVFVGWRLGGMIGIGTIISAFV
IGFCVQTTFKLLKFDATEIKHETLDQTYKTLFNNKKEQFHEEEVLKKGL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattttatgcccgtctgctgcgcttaatatgcggacttttcctatatgcactt
ggaattgttgttacaatgaatgcccatatgggatatgctccatgggatgttttccatgtt
ggatttgcaaaaacaataggaataagtatcggaaccgtttcgattataactggagtaatt
attggaataataacagtattgcttggtgaaaagcttggacttggtaccattttaaatatg
gtgcttattggagtgtttatagatatgcttcttggatttcatataatccctgtggcaagc
aacttcatgtttggaatcatcatgcttattgtagggttgtttataattgctttagcttca
tacttttacattgaatcagcgtttggagcaggtccaagggacagtttgatgtttgcactt
actcgaaaaacgggattacccgtaggtgtctgccgtggaacaattgagcttttagcagtg
tttgtcggatggaggctcgggggtatgattggtatcggaacaattatatctgcgtttgta
ataggattttgtgttcagacaacctttaagttgcttaagtttgatgcaacagaaattaaa
cacgaaacattagatcagacatataaaaccctttttaacaataaaaaagagcagtttcat
gaagaagaggtgcttaaaaagggtctataa

DBGET integrated database retrieval system