KEGG   Clostridium formicaceticum: BJL90_20830Help
Entry
BJL90_20830       CDS       T05005                                 

Definition
(GenBank) hypothetical protein
Organism
cfm  Clostridium formicaceticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 DDE_Tnp_1_3
Motif
Other DBs
NCBI-ProteinID: AOY78090
UniProt: A0A1D9FSE0
Position
4482374..4482712
Genome map
AA seq 112 aa AA seqDB search
MVYAKEILSDPKFIEQRGVRSIVDQDARVGHKSKTEHFFGYKDEQIITTDERIITVITIA
NGAYVDGTRFNELIELTKKTGLNTKEVYGDKAYFRKPMLDKIKKLKQSHIFQ
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
ttggtatatgcgaaagaaattctatcagatcctaaatttatagagcaaagaggagttcga
tcaatagttgatcaagatgccagagtaggtcataagagtaaaacagagcacttctttggg
tataaagatgagcagattattacaacagatgaaagaataattacagtcattacaatagcc
aatggagcatatgtagatggaacaagatttaatgaactaatagaattgacaaagaaaaca
ggattaaatactaaagaagtatatggtgataaagcatactttagaaagccaatgttagat
aaaataaaaaaattgaagcaaagccatatattccagtaa

DBGET integrated database retrieval system